Placental Lactogen/CSH1 Recombinant Protein Antigen

Images

 
There are currently no images for Placental Lactogen/CSH1 Recombinant Protein Antigen (NBP2-54710PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Placental Lactogen/CSH1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Placental Lactogen/CSH1

Source: E. coli

Amino Acid Sequence: SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CSH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54710.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Placental Lactogen/CSH1 Recombinant Protein Antigen

  • Choriomammotropin
  • chorionic somatomammotropin hormone 1 (placental lactogen)
  • chorionic somatomammotropin hormone
  • CS-1
  • CSAchorionic somatomammotropin A
  • CSH1
  • CSH2
  • CSMT
  • FLJ75407
  • hCS-A
  • Lactogen
  • PL
  • Placental Lactogen
  • PLchoriomammotropin

Background

Placental lactogen is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-90927
Species: Hu
Applications: IHC,  IHC-P, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
291-G1
Species: Hu
Applications: BA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
202-IL
Species: Hu
Applications: BA
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-16019
Species: Hu
Applications: IHC,  IHC-P, WB
4308-SE
Species: Hu
Applications: EnzAct
NBP3-38363
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA

Publications for Placental Lactogen/CSH1 Recombinant Protein Antigen (NBP2-54710PEP) (0)

There are no publications for Placental Lactogen/CSH1 Recombinant Protein Antigen (NBP2-54710PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Placental Lactogen/CSH1 Recombinant Protein Antigen (NBP2-54710PEP) (0)

There are no reviews for Placental Lactogen/CSH1 Recombinant Protein Antigen (NBP2-54710PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Placental Lactogen/CSH1 Recombinant Protein Antigen (NBP2-54710PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Placental Lactogen/CSH1 Products

Research Areas for Placental Lactogen/CSH1 Recombinant Protein Antigen (NBP2-54710PEP)

Find related products by research area.

Blogs on Placental Lactogen/CSH1

There are no specific blogs for Placental Lactogen/CSH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Placental Lactogen/CSH1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CSH1