Recombinant Human PKMYT1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PKMYT1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 400-499 of Human PKMYT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PASWLQPLGPPATPPGSPPCSLLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLSLFEDTLDPT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PKMYT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PKMYT1 Protein

  • DKFZp547K1610
  • EC 2.7.11.1
  • FLJ20093
  • Myt1 kinase
  • MYT1membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase
  • protein kinase, membrane associated tyrosine/threonine 1

Background

The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase preferentially phosphorylates and inactivates cell division cycle 2 protein (CDC2), and thus negatively regulates cell cycle G2/M transition. This kinase is associated with the membrane throughout the cell cycle. Its activity is highly regulated during the cell cycle. Protein kinases AKT1/PKB and PLK (Polo-like kinase) have been shown to phosphorylate and regulate the activity of this kinase. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP2-07219
Species: Hu
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF3444
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00009088-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PKMYT1 Partial Recombinant Protein (H00009088-Q01) (0)

There are no publications for PKMYT1 Partial Recombinant Protein (H00009088-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKMYT1 Partial Recombinant Protein (H00009088-Q01) (0)

There are no reviews for PKMYT1 Partial Recombinant Protein (H00009088-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKMYT1 Partial Recombinant Protein (H00009088-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKMYT1 Products

Bioinformatics Tool for PKMYT1 Partial Recombinant Protein (H00009088-Q01)

Discover related pathways, diseases and genes to PKMYT1 Partial Recombinant Protein (H00009088-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKMYT1 Partial Recombinant Protein (H00009088-Q01)

Discover more about diseases related to PKMYT1 Partial Recombinant Protein (H00009088-Q01).
 

Pathways for PKMYT1 Partial Recombinant Protein (H00009088-Q01)

View related products by pathway.

PTMs for PKMYT1 Partial Recombinant Protein (H00009088-Q01)

Learn more about PTMs related to PKMYT1 Partial Recombinant Protein (H00009088-Q01).
 

Research Areas for PKMYT1 Partial Recombinant Protein (H00009088-Q01)

Find related products by research area.

Blogs on PKMYT1

There are no specific blogs for PKMYT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PKMYT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PKMYT1