PKC theta Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PKC theta Antibody [NBP2-55717] - Staining of human cell line A549 shows localization to microtubule organizing center.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PKC theta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PKC theta Antibody - BSA Free (NBP2-55717) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-PKC theta Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKCQ
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot Reported in scientific literature (PMID:34073294)
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PKC theta Recombinant Protein Antigen (NBP2-55717PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:34073294).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PKC theta Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.13
• MGC126514
• MGC141919
• nPKC-theta
• PKC theta
• PRKCQ
• PRKCT
• protein kinase C theta type
• protein kinase C, theta

Background

Members of the protein kinase C (PKC) family play a key regulatory role in variety of cellular functions including cell growth and differentiation, gene expression, hormone secretion and membrane function. PKCs were originally identified as serine/threonine protein kinases whose activity was dependent on calcium and phospholipids. Diacylglycerols (DAG) and tumor promoting phorbol esters bind to and activate PKC. PKCs can be subdivided into at least two major classes including conventional (c) PKC isoforms (alpha, betaI, betaII and gamma) and novel (n) PKC isoforms (delta, episilon , zeta, eta and theta). Patterns of expression for each PKC isoform differs among tissues and PKC family members exhibit clear differences in their cofactor dependencies. For instance, the kinase activities of nPKC delta and episilon are independent of Ca++. On the other hand, nPKC and episilon, as well as all of the cPKC members, possess phorbol ester-binding activities and kinase activities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PKC theta Antibody (NBP2-55717)(1)

Publication using NBP2-55717

• Solanki AK, Biswal MR, Walterhouse S et al. Loss of Motor Protein MYO1C Causes Rhodopsin Mislocalization and Results in Impaired Visual Function Cells 2021-05-26 [PMID: 34073294] (WB, Mouse)

Bioinformatics

• Gene Symbol: PRKCQ