PKC epsilon Antibody - BSA Free

Western Blot: PKC epsilon Antibody [NBP2-38531] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuropil and neuronal cells.

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: PKC epsilon Antibody [NBP2-38531] - Staining in human cerebral cortex and pancreas tissues using anti-PRKCE antibody. Corresponding PRKCE RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PKC epsilon Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP
• Predicted Species: Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKCE
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PKC epsilon Protein (NBP2-38531PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PKC epsilon Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.13
• MGC125656
• nPKC-epsilon
• PKC epsilon
• PKCE
• PKCEMGC125657
• PRKCE
• protein kinase C epsilon type
• protein kinase C, epsilon

Background

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been shown to be involved in many different cellular functions, such as neuron channel activation, apoptosis, cardioprotection from ischemia, heat shock response, as well as insulin exocytosis. Knockout studies in mice suggest that this kinase is important for lipopolysaccharide (LPS)-mediated signaling in activated macrophages and may also play a role in controlling anxiety-like behavior.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKCE
• Uniprot:
  • Q02156()