PKC zeta Antibody

Images

 
Western Blot: PKC zeta Antibody [NBP1-87270] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-431
Immunocytochemistry/ Immunofluorescence: PKC zeta Antibody [NBP1-87270] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PKC zeta Antibody [NBP1-87270] - Staining of human retina shows strong cytoplasmic and membranous positivity in photoreceptor cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKC zeta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKCZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PKC zeta Protein (NBP1-87270PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PKC zeta Antibody

  • EC 2.7.11
  • EC 2.7.11.13
  • nPKC-zeta
  • PKC zeta
  • PKC2
  • PKC2PKC-ZETA
  • PRKCZ
  • protein kinase C zeta type
  • protein kinase C, zeta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
NBP2-19846
Species: Hu, Rt
Applications: WB, Func, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4585
Species: Hu
Applications: WB
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
AF5130
Species: Hu, Mu, Rt
Applications: WB
AF5134
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for PKC zeta Antibody (NBP1-87270) (0)

There are no publications for PKC zeta Antibody (NBP1-87270).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC zeta Antibody (NBP1-87270) (0)

There are no reviews for PKC zeta Antibody (NBP1-87270). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKC zeta Antibody (NBP1-87270) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKC zeta Products

Bioinformatics Tool for PKC zeta Antibody (NBP1-87270)

Discover related pathways, diseases and genes to PKC zeta Antibody (NBP1-87270). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC zeta Antibody (NBP1-87270)

Discover more about diseases related to PKC zeta Antibody (NBP1-87270).
 

Pathways for PKC zeta Antibody (NBP1-87270)

View related products by pathway.

PTMs for PKC zeta Antibody (NBP1-87270)

Learn more about PTMs related to PKC zeta Antibody (NBP1-87270).

Blogs on PKC zeta

There are no specific blogs for PKC zeta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKC zeta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCZ
Entrez