PKC delta Antibody (7I5U6)

Western Blot: PKC delta Antibody (7I5U6) [NBP3-16660] - Western blot analysis of extracts of various cell lines, using PKC delta Rabbit mAb (NBP3-16660) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunohistochemistry analysis of PKC delta in paraffin-embedded human thyroid tissue using PKC delta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunohistochemistry analysis of PKC delta in paraffin-embedded mouse brain tissue using PKC delta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunofluorescence analysis of NIH-3T3 cells using PKC delta Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunohistochemistry analysis of PKC delta in paraffin-embedded human spleen tissue using PKC delta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunohistochemistry analysis of PKC delta in paraffin-embedded mouse colon tissue using PKC delta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: PKC delta Antibody (7I5U6) [NBP3-16660] - Immunohistochemistry analysis of PKC delta in paraffin-embedded mouse testis tissue using PKC delta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 7I5U6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PKC delta Antibody (7I5U6) Summary

• Description: Novus Biologicals Rabbit PKC delta Antibody (7I5U6) (NBP3-16660) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 547-653 of human PKC delta (Q05655). PFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLID
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PRKCD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PKC delta Antibody (7I5U6)

• EC 2.7.11
• EC 2.7.11.13
• MAY1
• MGC49908
• nPKC-delta
• PKC delta
• PKCD
• PKCy
• PRKCD
• protein kinase C delta type
• protein kinase C delta VIII
• protein kinase C, delta

Background

PKC-delta has a biological activity which is closely related to Pkc1, and PKC-delta activates the Pkc1-mediated pathway through an activation of the Bck1 kinase. PKC-delta appears to play a critical role in growth control of yeast and mammalian cells. Suppression experiments suggest that PKC-delta desensitizes the pathway by regulating an aspect of G protein function (1). PKC-delta phosphorylates hRad9 in vitro and in cells exposed to genotoxic agents. It has been shown that PKC-delta is required for binding of hRad9 to Bcl-2. In concert with these results, inhibition of PKC-delta attenuates Rad9-mediated apoptosis. These findings demonstrate that PKC-delta is responsible for the regulation of Rad9 in the Hus1-Rad1 complex and in the apoptotic response to DNA damage (2). It has been reported a mechanism for the regulation of peripheral B-cell survival by serine/threonine protein kinase Cdelta (PKC-delta): spontaneous death of resting B cells is regulated by nuclear localization of PKC-delta that contributes to phosphorylation of histone H2B at serine 14 (S14-H2B) (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKCD