PKC beta Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PKC beta Antibody [NBP3-35369] - Immunofluorescence analysis of C6 cells using PKC beta Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: PKC beta Antibody [NBP3-35369] - Western blot analysis of various lysates using PKC beta Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunohistochemistry: PKC beta Antibody [NBP3-35369] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using PKC beta Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: PKC beta Antibody [NBP3-35369] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using PKC beta Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: PKC beta Antibody [NBP3-35369] - Immunofluorescence analysis of NIH-3T3 cells using PKC beta Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PKC beta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PKC beta Antibody - BSA Free (NBP3-35369) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 260-340 of human PKC beta (NP_997700.1).
  
  Sequence:
  SFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKCB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 77 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for PKC beta Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.13
• MGC41878
• PKC-B
• PKC-beta
• PKCBPRKCB2
• PRKCB1protein kinase C beta 1
• protein kinase C beta type
• protein kinase C, beta 1 polypeptide
• protein kinase C, beta 1
• protein kinase C, beta

Background

PKCbetaII is a member of the serine/threonine protein kinase C (PKC) family (1) that includes 10 closely related isozymes classified as the

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKCB