PKC beta Antibody


Immunocytochemistry/ Immunofluorescence: PKC beta Antibody [NBP2-38579] - Staining of human cell line RT4 shows localization to nucleoplasm & cytosol.
Immunohistochemistry: PKC beta Antibody [NBP2-38579] - Staining of human pancreas shows weak nuclear positivity in exocrine glandular cells and weak cytoplasmic in islets of Langerhans.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

PKC beta Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVIN
Specificity of human PKC beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PKC beta Protein (NBP2-38579PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PKC beta Antibody

  • EC 2.7.11
  • EC
  • MGC41878
  • PKC-B
  • PKC-beta
  • PRKCB1protein kinase C beta 1
  • protein kinase C beta type
  • protein kinase C, beta 1 polypeptide
  • protein kinase C, beta 1
  • protein kinase C, beta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PKC beta Antibody (NBP2-38579) (0)

There are no publications for PKC beta Antibody (NBP2-38579).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC beta Antibody (NBP2-38579) (0)

There are no reviews for PKC beta Antibody (NBP2-38579). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PKC beta Antibody (NBP2-38579) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PKC beta Antibody (NBP2-38579)

Discover related pathways, diseases and genes to PKC beta Antibody (NBP2-38579). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC beta Antibody (NBP2-38579)

Discover more about diseases related to PKC beta Antibody (NBP2-38579).

Pathways for PKC beta Antibody (NBP2-38579)

View related products by pathway.

PTMs for PKC beta Antibody (NBP2-38579)

Learn more about PTMs related to PKC beta Antibody (NBP2-38579).

Research Areas for PKC beta Antibody (NBP2-38579)

Find related products by research area.

Blogs on PKC beta

There are no specific blogs for PKC beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PKC beta Antibody and receive a gift card or discount.


Gene Symbol PRKCB