PKA C alpha Antibody - BSA Free

Western Blot: PKA C alpha Antibody [NBP2-57042] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: PKA C alpha Antibody [NBP2-57042] - Staining of human cell line MCF7 shows localization to cytosol & cytokinetic bridge. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PKA C alpha Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PKA C alpha Antibody - BSA Free (NBP2-57042) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVP
• Predicted Species: Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKACA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PKA C alpha Recombinant Protein Antigen (NBP2-57042PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PKA C alpha Antibody - BSA Free

• cAMP-dependent protein kinase catalytic subunit alpha
• Cs
• EC 2.7.11
• EC 2.7.11.11
• MGC102831
• MGC48865
• PKA C alpha
• PKA C-alpha
• Pkaca
• PKCA1
• PKCD
• PRKACA
• protein kinase A catalytic subunit
• protein kinase, cAMP-dependent, catalytic, alpha

Background

PKA (Protein Kinase A), also known as cAMP-dependent protein kinase, phosphorylates serine or threonine residues in target protein in response to elevated levels of cAMP. Inactive PKA exists as a tetrameric protein composed of two regulatory (R) subunits and two catalytic (C) subunits. Activation occurs when two cAMP molecules bind to each R subunit which causes a conformational change that releases the active C subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKACA