PIMT Recombinant Protein Antigen

Images

 
There are currently no images for PIMT Recombinant Protein Antigen (NBP1-92271PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PIMT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TGS1.

Source: E. coli

Amino Acid Sequence: PELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TGS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92271.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PIMT Recombinant Protein Antigen

  • Cap-specific guanine-N2 methyltransferase
  • CLL-associated antigen KW-2
  • DKFZp762A163
  • EC 2.1.1
  • EC 2.1.1.-
  • HCA137
  • Hepatocellular carcinoma-associated antigen 137
  • NCOA6IPSEREX-defined
  • nuclear receptor coactivator 6 interacting protein
  • Nuclear receptor coactivator 6-interacting protein
  • PIMTFLJ22995
  • PIPMT
  • PRIP-interacting protein PIPMT
  • PRIP-interacting protein with methyltransferase domain
  • PRIP-interacting protein with methyltransferase motif
  • trimethylguanosine synthase 1
  • trimethylguanosine synthase homolog (S. cerevisiae)
  • trimethylguanosine synthase homolog
  • trimethylguanosine synthase

Background

Nuclear receptor coactivators participate in the transcriptional activation of specific genes by nuclear receptors. A new nuclear receptor coactivator-interacting protein, designated PIMT, was identified from a human liver cDNA library by using the coactivator peroxisome proliferator-activated receptor-interacting protein (PRIP) as bait in a yeast 2-hybrid screen. The PIMT cDNA encodes an 852-amino acid protein containing a 9-amino acid methyltransferase motif I (VVDAFCGVG) and an invariant segment (GXXGXXI) found in K-homology motifs of many RNA-binding proteins. Northern blot analysis demonstrated ubiquitous expression of a 3.2-kb PIMT transcript, with highest expression in heart, skeletal muscle, kidney, liver, and placenta. Immunofluorescence studies showed that the PIMT and PRIP proteins are colocalized in the nucleus. PIMT binds 5-adenosyl-L-methionine, the methyl donor for the methyltransfer reaction, and it also binds RNA, suggesting that it is an RNA methyltransferase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-335
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-85806
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-2574
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-80896
Species: Hu
Applications: IHC,  IHC-P
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-81680
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
DY393
Species: Hu
Applications: ELISA
NBP1-83280
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF6270
Species: Hu
Applications: ICC
NB100-1020
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-92271PEP
Species: Hu
Applications: AC

Publications for PIMT Recombinant Protein Antigen (NBP1-92271PEP) (0)

There are no publications for PIMT Recombinant Protein Antigen (NBP1-92271PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIMT Recombinant Protein Antigen (NBP1-92271PEP) (0)

There are no reviews for PIMT Recombinant Protein Antigen (NBP1-92271PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PIMT Recombinant Protein Antigen (NBP1-92271PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIMT Products

Array NBP1-92271PEP

Research Areas for PIMT Recombinant Protein Antigen (NBP1-92271PEP)

Find related products by research area.

Blogs on PIMT

There are no specific blogs for PIMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PIMT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TGS1