pIgR Antibody - BSA Free

Immunohistochemistry-Paraffin: pIgR Antibody [NBP1-86095] - Analysis in human duodenum and skeletal muscle tissues. Corresponding PIGR RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: pIgR Antibody [NBP1-86095] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: pIgR Antibody [NBP1-86095] - Staining of human duodenum shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: pIgR Antibody [NBP1-86095] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: pIgR Antibody [NBP1-86095] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in human colon tissue.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

pIgR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIGR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25397670). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  pIgR Protein (NBP1-86095PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24236214)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for pIgR Antibody - BSA Free

• FLJ22667
• hepatocellular carcinoma associated protein TB6
• Hepatocellular carcinoma-associated protein TB6
• MGC125361
• MGC125362
• pIgR
• Poly-Ig receptor
• polymeric immunoglobulin receptor

Background

The PIGR gene is a member of the immunoglobulin superfamily. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells; the complex is then transported across the cell to be secreted at the apical sur

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for pIgR Antibody (NBP1-86095)(5)

Publications using NBP1-86095

• Yan Li, Renee B. Chang, Meredith L. Stone, Devora Delman, Kelly Markowitz, Yuqing Xue, Heather Coho, Veronica M. Herrera, Joey H. Li, Liti Zhang, Shaanti Choi-Bose, Michael Giannone, Sarah M. Shin, Erin M. Coyne, Alexei Hernandez, Nicole E. Gross, Soren Charmsaz, Won Jin Ho, Jae W. Lee, Gregory L. Beatty Multimodal immune phenotyping reveals microbial-T cell interactions that shape pancreatic cancer Cell Reports Medicine 2024-02-01 [PMID: 38307029]
• Fristedt R, Elebro J, Gaber A et al. Reduced Expression of the Polymeric Immunoglobulin Receptor in Pancreatic and Periampullary Adenocarcinoma Signifies Tumour Progression and Poor Prognosis. PLoS One 2014-01-01 [PMID: 25397670] (IF/IHC, Human)
• Fristedt R, Gaber A, Hedner C et al. Expression and prognostic significance of the polymeric immunoglobulin receptor in esophageal and gastric adenocarcinoma. J Transl Med 2014-04-02 [PMID: 24694107]
• Berntsson J, Lundgren S, Nodin B et al. Expression and prognostic significance of the polymeric immunoglobulin receptor in epithelial ovarian cancer. J Ovarian Res 2014-02-26 [PMID: 24568264]
• Trevisi P, Gandolfi G, Priori D et al. Age-Related Expression of the Polymeric Immunoglobulin Receptor (pIgR) in the Gastric Mucosa of Young Pigs. PLoS One 2013-01-01 [PMID: 24236214] (IF/IHC)

Bioinformatics

• Gene Symbol: PIGR