Piccolo Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Piccolo Antibody [NBP1-90250] - Staining of human cell line U-251 MG shows localization to nuclear speckles & plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Piccolo Antibody [NBP1-90250] - Staining of human cerebellum shows strong positivity in neuropil.

Immunohistochemistry-Paraffin: Piccolo Antibody [NBP1-90250] - Staining of human cerebral cortex shows strong positivity in neuropil.

Immunohistochemistry-Paraffin: Piccolo Antibody [NBP1-90250] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Piccolo Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PITTLDSITTVYTEPVDMITKFEDSEEISSSTYFPGSIIDYPEEISVSLDRTAPPDGRASADHIVISLSDMASSIIESVVPKPEGPVADTVSTDLLISEKDPVKKAKKETGNGIILEVLEA
• Marker: Synaptic Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCLO
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Piccolo Protein (NBP1-90250PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Piccolo Antibody - BSA Free

• ACZ
• Aczonin
• PCLO
• piccolo (presynaptic cytomatrix protein)
• Piccolo
• protein piccolo

Background

Piccolo is a presynaptic cytomatrix protein concentrated at the presynaptic side of synaptic junctions. Piccolo is a large protein which constists of an N-terminal Zn2+ finger, several piccolo-bassoon homology domains (PBH-domains) and C-terminal PDZ and C2 domains. It is usually found together with bassoon, a related huge multi-domain protein of the CAZ (cytoskeletal matric assembled at active zones). Piccolo is a scaffolding protein for proteins involved in endo- and exocytosis of synaptic vesicles. Recently piccolo has been shown to interfere with clathrin mediated endocytosis by binding to the F-actin and dynamin binding protein Abp1. Piccolo is highly expressed in brain with low levels found in stomach. It is not detected in other tissues analyzed including adrenal gland, testis and pancreas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Piccolo Antibody (NBP1-90250)(2)

Publications using NBP1-90250

• Moriai H, Yokoyama T, Abdali SS, Nakamuta N et Al. Distribution of proteins for synaptic release in nerve endings associated with the trachealis muscle of rats Auton Neurosci 2022-11-12 [PMID: 36370593]
• Yamamoto Y, Moriai H, Yokoyama T, Nakamuta N Immunohistochemical distribution of proteins involved in glutamate release in subepithelial sensory nerve endings of rat epiglottis Histochemistry and cell biology 2021-10-06 [PMID: 34613496]

Bioinformatics

• Gene Symbol: PCLO