SV2A Antibody

Images

 
Western Blot: SV2A Antibody [NBP1-82964] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SV2A Antibody [NBP1-82964] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - staining of human cerebral cortex shows distinct positivity in neuropil.
Western Blot: SV2A Antibody [NBP1-82964] - Analysis of SV2A in (1) undifferentiated SH-SY5Y, (2) differentiated SH-SY5Y (neurons) and (3) mouse brain using anti-SV2A antibody. 30ug of protein/lane. Image from verified ...read more
Western Blot: SV2A Antibody [NBP1-82964] - Analysis in human cell line U-87 MG.
Immunoprecipitation: SV2A Antibody [NBP1-82964] - Staining of neuroblastoma cells SH-SY5Y differentiated into neurons. Lane (1) 10ug of input, 500ug used for IP. 10ul of antibody used for incubation with lysate ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SV2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SV2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SV2A Protein (NBP1-82964PEP)
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-82964 in the following applications:

Publications
Read Publications using
NBP1-82964 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SV2A Antibody

  • KIAA0736
  • KIAA0736SV2
  • SV2
  • SV2A
  • synaptic vesicle glycoprotein 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92462
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP1-85849
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-91348
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46641
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NB300-104
Species: Hu, Mu, Rt, Bv, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, IHC-FrFl
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-82964
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for SV2A Antibody (NBP1-82964)(2)

Reviews for SV2A Antibody (NBP1-82964) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.
We have 2 reviews tested in 2 application: WB, IP.

Reviews using NBP1-82964:
Filter by Applications
WB
(1)
IP
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot SV2A NBP1-82964
Enlarge
reviewed by:
Anonymous
WB Human 01/28/2015
View

Summary

ApplicationWestern Blot
Sample TestedL1: undifferentiated SH-SY5Y, L2: differentiated SH-Sy5Y (neurons), L3: Mouse Brain
SpeciesHuman
LotA74250

Blocking

Blocking Details5% Milk-TBS/T 1 Hour, Room Temp.

Primary Anitbody

Dilution Ratio1:250 in 5% milk/TBS-T

Secondary Antibody

Secondary DescriptionECL Rabbit IgG, HRP-linked whole Ab (from donkey), 1mL
Secondary Manufacturer Cat#NA934-1ML
Secondary Concentration1:5000

Details

Detection NotesECL, 20 minute exposure

Comments

CommentsL1: undifferentiated SH-SY5Y, L2: differentiated SH-Sy5Y (neurons), L3: Mouse Brain. 30ug of protein/ lane. PVDF membrane.
Immunoprecipitation SV2A NBP1-82964
Enlarge
reviewed by:
Anonymous
IP Human 01/28/2015
View

Summary

ApplicationImmunoprecipitation
Sample TestedNeuroblastoma cells SH-SY5Y differentiated into neurons
SpeciesHuman
LotA74250

Blocking

Blocking Details5% Milk-TBS/T 1 Hour, Room Temp.

Primary Anitbody

Dilution Ratio1:250 in 5% milk/TBS-T

Secondary Antibody

Secondary DescriptionECL Rabbit IgG, HRP-linked whole Ab (from donkey), 1mL
Secondary Manufacturer Cat#NA934-1ML
Secondary Concentration1:5000

Details

Detection NotesECL, 10 minute exposure
Immunoprecipitation DetailsRoche Agarose A beads 50ul slurry, 2 hour 4C incubation (post pre-clear), 4 washes in 1X Ripa buffer, 8 min each
Elution Description1X LDS buffer, 95C 3 min + DTT

Comments

Comments10ug of input in lane 1, 500ug used for IP. 10ul of antibody used for incubation with lysate (4C o/n w/ rotation) prior to addition of beads.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SV2A Antibody (NBP1-82964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SV2A Products

Bioinformatics Tool for SV2A Antibody (NBP1-82964)

Discover related pathways, diseases and genes to SV2A Antibody (NBP1-82964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SV2A Antibody (NBP1-82964)

Discover more about diseases related to SV2A Antibody (NBP1-82964).
 

Pathways for SV2A Antibody (NBP1-82964)

View related products by pathway.

PTMs for SV2A Antibody (NBP1-82964)

Learn more about PTMs related to SV2A Antibody (NBP1-82964).

Blogs on SV2A

There are no specific blogs for SV2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

Anonymous
01/28/2015
Application: WB
Species: Human

Anonymous
01/28/2015
Application: IP
Species: Human

Bioinformatics

Gene Symbol SV2A
Entrez