PIAS3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PIAS3 Antibody - BSA Free (NBP2-57238) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD |
| Predicted Species |
Mouse (93%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PIAS3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PIAS3 Antibody - BSA Free
Background
PIAS3 encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for PIAS3 Antibody (NBP2-57238) (0)
There are no publications for PIAS3 Antibody (NBP2-57238).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIAS3 Antibody (NBP2-57238) (0)
There are no reviews for PIAS3 Antibody (NBP2-57238).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PIAS3 Antibody (NBP2-57238) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PIAS3 Products
Research Areas for PIAS3 Antibody (NBP2-57238)
Find related products by research area.
|
Blogs on PIAS3