PI 3-Kinase p110 delta Antibody

Images

 
Western Blot: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Lane 1: Marker [kDa] 250,130,100,70,55,35,25,15,10. Lane 2: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytokinetic bridge & vesicles.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining in human lymph node and colon tissues using anti-PIK3CD antibody. Corresponding PIK3CD RNA-seq data ...read more
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human appendix shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human lymph node shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PI 3-Kinase p110 delta Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN
Specificity
Specificity of human PI 3-Kinase p110 delta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIK3CD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
PI 3-Kinase p110 delta Knockout HeLa Cell Lysate
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PI 3-Kinase p110 delta Antibody

  • EC 2.7.1
  • EC 2.7.1.153
  • p110D
  • P110DELTA
  • Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta
  • phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  • phosphoinositide-3-kinase C
  • phosphoinositide-3-kinase, catalytic, delta polypeptide
  • PI 3Kinase p110 delta
  • PI 3-Kinase p110 delta
  • PI3K
  • PI3K-delta
  • PI3-kinase p110 subunit delta
  • PI3-kinase subunit delta
  • PIK3CD
  • PtdIns-3-kinase subunit delta
  • PtdIns-3-kinase subunit p110-delta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC, IHC-P, KO
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO

Publications for PI 3-Kinase p110 delta Antibody (NBP2-38535) (0)

There are no publications for PI 3-Kinase p110 delta Antibody (NBP2-38535).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p110 delta Antibody (NBP2-38535) (0)

There are no reviews for PI 3-Kinase p110 delta Antibody (NBP2-38535). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PI 3-Kinase p110 delta Antibody (NBP2-38535) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PI 3-Kinase p110 delta Products

Bioinformatics Tool for PI 3-Kinase p110 delta Antibody (NBP2-38535)

Discover related pathways, diseases and genes to PI 3-Kinase p110 delta Antibody (NBP2-38535). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PI 3-Kinase p110 delta Antibody (NBP2-38535)

Discover more about diseases related to PI 3-Kinase p110 delta Antibody (NBP2-38535).
 

Pathways for PI 3-Kinase p110 delta Antibody (NBP2-38535)

View related products by pathway.

PTMs for PI 3-Kinase p110 delta Antibody (NBP2-38535)

Learn more about PTMs related to PI 3-Kinase p110 delta Antibody (NBP2-38535).
 

Research Areas for PI 3-Kinase p110 delta Antibody (NBP2-38535)

Find related products by research area.

Blogs on PI 3-Kinase p110 delta.

PI3 Kinase p110 delta - A cell-type specific lipid kinase with essential roles in leukocyte biology
Phosphatidylinositol 3-kinases (PI3Ks) are a group of lipid kinases with important roles in signal transduction. PI3Ks are involved in signal propagation for diverse receptors including tyrosine kinase receptors and G-protein coupled receptors. Cla...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PI 3-Kinase p110 delta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3CD