PI 3-Kinase C2 beta Antibody - BSA Free

Immunohistochemistry: PI 3-Kinase C2 beta Antibody [NBP1-86795] - Staining of human appendix shows strong cytoplasmic and membrane positivity in glandular epithelium.

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Staining of human kidney shows strong membranous positivity in subset of cells in tubules.

Staining of human small intestine shows strong membranous positivity in glandular cells.

Staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PI 3-Kinase C2 beta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ITSALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELYCNTFNADFQTAVPGSRKHDLVQEACHFARSLAFTVYATHR
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIK3C2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PI 3-Kinase C2 beta Protein (NBP1-86795PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PI 3-Kinase C2 beta Antibody - BSA Free

• C2-PI3K
• C2-PI3KDKFZp686G16234
• EC 2.7.1
• EC 2.7.1.154
• phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide
• phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta
• Phosphoinositide 3-kinase-C2-beta
• phosphoinositide-3-kinase, class 2, beta polypeptide
• PI 3Kinase C2 beta
• PI 3-Kinase C2 beta
• PI3K-C2beta
• PI3K-C2-beta
• PIK3C2B
• PTDINS-3-kinase C2 beta
• PtdIns-3-kinase C2 subunit beta

Background

PIK3C2B is encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIK3C2B
• Entrez:
  • 5287(Human)
• Uniprot:
  • O00750(Human)