PHYHIP Antibody - BSA Free

Western Blot: PHYHIP Antibody [NBP1-56325] - Transfected 293T cell lysate, concentration 1.25ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

PHYHIP Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PHYHIP(phytanoyl-CoA 2-hydroxylase interacting protein) The peptide sequence was selected from the N terminal of PHYHIP. Peptide sequence VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHYHIP
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for PHYHIP Antibody - BSA Free

• DYRK1A interacting protein 3
• DYRK1AP3
• KIAA0273PAHX-AP1
• PAHX-AP
• PAHXAP1
• phytanoyl-CoA 2-hydroxylase interacting protein
• phytanoyl-CoA alpha-hydroxylase associated protein
• phytanoyl-CoA hydroxylase interacting protein
• Phytanoyl-CoA hydroxylase-associated protein 1
• phytanoyl-CoA hydroxylase-interacting protein

Background

PHYHIP interacts with PHYH suggests a role in the development of the central system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHYHIP
• Uniprot:
  • Q92561(Human)