REPIN1 Antibody

Images

 
Western Blot: REPIN1 Antibody [NBP1-89059] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: REPIN1 Antibody [NBP1-89059] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: REPIN1 Antibody [NBP1-89059] - Staining of human urinary bladder shows distinct nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

REPIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REPIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
REPIN1 Protein (NBP1-89059PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for REPIN1 Antibody

  • 60 kDa origin-specific DNA-binding protein
  • 60 kDa replication initiation region protein
  • ATT-binding protein
  • DHFR oribeta-binding protein RIP60
  • H_DJ0584D14.12
  • replication initiation region protein (60kD)
  • replication initiator 1
  • RIP60AP4
  • Zfp464
  • zinc finger protein 464 (RIP60)
  • Zinc finger protein 464
  • zinc finger protein AP4
  • zinc finger proten AP4
  • ZNF464

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00006532-M06
Species: Hu
Applications: ELISA, IP

Publications for REPIN1 Antibody (NBP1-89059) (0)

There are no publications for REPIN1 Antibody (NBP1-89059).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REPIN1 Antibody (NBP1-89059) (0)

There are no reviews for REPIN1 Antibody (NBP1-89059). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for REPIN1 Antibody (NBP1-89059) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional REPIN1 Products

Bioinformatics Tool for REPIN1 Antibody (NBP1-89059)

Discover related pathways, diseases and genes to REPIN1 Antibody (NBP1-89059). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for REPIN1 Antibody (NBP1-89059)

Discover more about diseases related to REPIN1 Antibody (NBP1-89059).
 

Pathways for REPIN1 Antibody (NBP1-89059)

View related products by pathway.

PTMs for REPIN1 Antibody (NBP1-89059)

Learn more about PTMs related to REPIN1 Antibody (NBP1-89059).

Blogs on REPIN1

There are no specific blogs for REPIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our REPIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REPIN1