PHYH Antibody

Images

 
Western Blot: PHYH Antibody [NBP1-87348] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: PHYH Antibody [NBP1-87348] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHYH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHYH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PHYH Protein (NBP1-87348PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHYH Antibody

  • LNAP1
  • PAHXLN1
  • peroxisomal
  • PhyH
  • PHYH1
  • phytanoyl-CoA 2-hydroxylase
  • phytanoyl-CoA hydroxylase (Refsum disease)
  • phytanoyl-CoA hydroxylase
  • RD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-38473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
MAB2358
Species: Hu, Mu
Applications: IHC, ICC

Publications for PHYH Antibody (NBP1-87348) (0)

There are no publications for PHYH Antibody (NBP1-87348).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHYH Antibody (NBP1-87348) (0)

There are no reviews for PHYH Antibody (NBP1-87348). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHYH Antibody (NBP1-87348) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHYH Products

Bioinformatics Tool for PHYH Antibody (NBP1-87348)

Discover related pathways, diseases and genes to PHYH Antibody (NBP1-87348). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHYH Antibody (NBP1-87348)

Discover more about diseases related to PHYH Antibody (NBP1-87348).
 

Pathways for PHYH Antibody (NBP1-87348)

View related products by pathway.

PTMs for PHYH Antibody (NBP1-87348)

Learn more about PTMs related to PHYH Antibody (NBP1-87348).
 

Research Areas for PHYH Antibody (NBP1-87348)

Find related products by research area.

Blogs on PHYH

There are no specific blogs for PHYH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHYH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHYH