Phosphoserine phosphatase Antibody

Images

 
Western Blot: Phosphoserine phosphatase Antibody [NBP1-87203] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: Phosphoserine phosphatase Antibody [NBP1-87203] - Staining of human prostate shows strong positivity in basal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phosphoserine phosphatase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSPH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Phosphoserine phosphatase Recombinant Protein Antigen (NBP1-87203PEP)
Publications
Read Publication using NBP1-87203.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Phosphoserine phosphatase Antibody

  • L-3-phosphoserine phosphatase
  • O-phosphoserine phosphohydrolase
  • phosphoserine phosphatase
  • PSPase
  • PSPEC 3.1.3.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-37493
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF4937
Species: Hu
Applications: WB, IHC
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-82452
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-45897
Species: Hu
Applications: WB, IHC
9094-AG
Species: Hu
NBP1-87203
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Phosphoserine phosphatase Antibody (NBP1-87203)(1)

Reviews for Phosphoserine phosphatase Antibody (NBP1-87203) (0)

There are no reviews for Phosphoserine phosphatase Antibody (NBP1-87203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phosphoserine phosphatase Antibody (NBP1-87203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Phosphoserine phosphatase Products

Bioinformatics Tool for Phosphoserine phosphatase Antibody (NBP1-87203)

Discover related pathways, diseases and genes to Phosphoserine phosphatase Antibody (NBP1-87203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phosphoserine phosphatase Antibody (NBP1-87203)

Discover more about diseases related to Phosphoserine phosphatase Antibody (NBP1-87203).
 

Pathways for Phosphoserine phosphatase Antibody (NBP1-87203)

View related products by pathway.

PTMs for Phosphoserine phosphatase Antibody (NBP1-87203)

Learn more about PTMs related to Phosphoserine phosphatase Antibody (NBP1-87203).
 

Research Areas for Phosphoserine phosphatase Antibody (NBP1-87203)

Find related products by research area.

Blogs on Phosphoserine phosphatase

There are no specific blogs for Phosphoserine phosphatase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phosphoserine phosphatase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSPH
Entrez
Uniprot