Phosducin Antibody


Immunohistochemistry-Paraffin: Phosducin Antibody [NBP2-56992] - Staining of retina shows strong cytoplasmic and nuclear positivity in photoreceptor layer.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Phosducin Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DWRKFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELI
Specificity of human Phosducin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Phosducin Recombinant Protein Antigen (NBP2-56992PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Phosducin Antibody

  • 33 kDa phototransducing protein
  • 33kDA phototransducing protein
  • G beta gamma binding protein
  • PHD
  • PhLP
  • phosducin
  • phosducin-like orphan protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
Species: Hu, Ca
Applications: WB, Flow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for Phosducin Antibody (NBP2-56992) (0)

There are no publications for Phosducin Antibody (NBP2-56992).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phosducin Antibody (NBP2-56992) (0)

There are no reviews for Phosducin Antibody (NBP2-56992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Phosducin Antibody (NBP2-56992) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Phosducin Antibody (NBP2-56992)

Discover related pathways, diseases and genes to Phosducin Antibody (NBP2-56992). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phosducin Antibody (NBP2-56992)

Discover more about diseases related to Phosducin Antibody (NBP2-56992).

Pathways for Phosducin Antibody (NBP2-56992)

View related products by pathway.

PTMs for Phosducin Antibody (NBP2-56992)

Learn more about PTMs related to Phosducin Antibody (NBP2-56992).

Research Areas for Phosducin Antibody (NBP2-56992)

Find related products by research area.

Blogs on Phosducin

There are no specific blogs for Phosducin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Phosducin Antibody and receive a gift card or discount.


Gene Symbol PDC