Phosducin Antibody

Images

 
Immunohistochemistry-Paraffin: Phosducin Antibody [NBP2-56992] - Immunohistochemical staining of human testis shows strong acrosome positivity in subsets of cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phosducin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DWRKFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELI
Specificity
Specificity of human Phosducin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Phosducin Recombinant Protein Antigen (NBP2-56992PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Phosducin Antibody

  • 33 kDa phototransducing protein
  • 33kDA phototransducing protein
  • G beta gamma binding protein
  • PHD
  • PhLP
  • phosducin
  • phosducin-like orphan protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85079
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF1436
Species: Mu
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-62689
Species: Hu
Applications: IHC
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-56992
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for Phosducin Antibody (NBP2-56992) (0)

There are no publications for Phosducin Antibody (NBP2-56992).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phosducin Antibody (NBP2-56992) (0)

There are no reviews for Phosducin Antibody (NBP2-56992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Phosducin Antibody (NBP2-56992) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Phosducin Products

Bioinformatics Tool for Phosducin Antibody (NBP2-56992)

Discover related pathways, diseases and genes to Phosducin Antibody (NBP2-56992). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phosducin Antibody (NBP2-56992)

Discover more about diseases related to Phosducin Antibody (NBP2-56992).
 

Pathways for Phosducin Antibody (NBP2-56992)

View related products by pathway.

PTMs for Phosducin Antibody (NBP2-56992)

Learn more about PTMs related to Phosducin Antibody (NBP2-56992).
 

Research Areas for Phosducin Antibody (NBP2-56992)

Find related products by research area.

Blogs on Phosducin

There are no specific blogs for Phosducin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phosducin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDC