PHLDA1 Antibody

Images

 
Western Blot: PHLDA1 Antibody [NBP1-53065] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHLDA1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PHLDA1(pleckstrin homology-like domain, family A, member 1) The peptide sequence was selected from the middle region of PHLDA1. Peptide sequence PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHLDA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PHLDA1 and was validated on Western blot.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PHLDA1 Antibody

  • Apoptosis-associated nuclear protein
  • DT1P1B11
  • MGC131738
  • PHRIPT-cell death-associated gene 51 protein
  • pleckstrin homology-like domain family A member 1
  • pleckstrin homology-like domain, family A, member 1
  • PQ-rich protein
  • Proline- and glutamine-rich protein
  • Proline- and histidine-rich protein
  • proline-histidine rich protein
  • TDAG51PQR protein

Background

PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-53308
Species: Hu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-53065
Species: Hu
Applications: WB

Publications for PHLDA1 Antibody (NBP1-53065) (0)

There are no publications for PHLDA1 Antibody (NBP1-53065).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHLDA1 Antibody (NBP1-53065) (0)

There are no reviews for PHLDA1 Antibody (NBP1-53065). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHLDA1 Antibody (NBP1-53065) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHLDA1 Products

Bioinformatics Tool for PHLDA1 Antibody (NBP1-53065)

Discover related pathways, diseases and genes to PHLDA1 Antibody (NBP1-53065). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHLDA1 Antibody (NBP1-53065)

Discover more about diseases related to PHLDA1 Antibody (NBP1-53065).
 

Pathways for PHLDA1 Antibody (NBP1-53065)

View related products by pathway.

PTMs for PHLDA1 Antibody (NBP1-53065)

Learn more about PTMs related to PHLDA1 Antibody (NBP1-53065).

Blogs on PHLDA1

There are no specific blogs for PHLDA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHLDA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHLDA1