PHF7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PHF7 Antibody [NBP2-49628] - Staining of human cell line HaCaT shows localization to nuclear speckles & the Golgi apparatus.
Immunohistochemistry-Paraffin: PHF7 Antibody [NBP2-49628] - Staining of human testis shows moderate nuclear positivity.
Immunohistochemistry-Paraffin: PHF7 Antibody [NBP2-49628] - Staining of human prostate shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PHF7 Antibody [NBP2-49628] - Staining in human testis and prostate tissues using anti-PHF7 antibody. Corresponding PHF7 RNA-seq data are presented for the ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PHF7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEE
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHF7 Recombinant Protein Antigen (NBP2-49628PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHF7 Antibody

  • DKFZp434L1850
  • HSPC045
  • HSPC226
  • MGC26088
  • NYD-SP6
  • PHD finger protein 7
  • Testis development protein NYD-SP6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01086
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
255-SC/CF
Species: Hu
Applications: BA
NBP1-90117
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-38302
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83493
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB110-61010
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC, IHC-P
5334-KL
Species: Hu
Applications: BA
NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-22360
Species: Hu, Mu
Applications: ICC/IF, IP, WB
AF4078
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB21-2000
Species: Hu, Ma, Mu, Rt
Applications: ChIP, DB, ICC/IF, WB
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
H00132160-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-33482
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-98957
Species: Hu
Applications: ICC/IF, IHC, IP, RIA, WB

Publications for PHF7 Antibody (NBP2-49628) (0)

There are no publications for PHF7 Antibody (NBP2-49628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF7 Antibody (NBP2-49628) (0)

There are no reviews for PHF7 Antibody (NBP2-49628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PHF7 Antibody (NBP2-49628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF7 Products

Bioinformatics Tool for PHF7 Antibody (NBP2-49628)

Discover related pathways, diseases and genes to PHF7 Antibody (NBP2-49628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF7 Antibody (NBP2-49628)

Discover more about diseases related to PHF7 Antibody (NBP2-49628).
 

Pathways for PHF7 Antibody (NBP2-49628)

View related products by pathway.

PTMs for PHF7 Antibody (NBP2-49628)

Learn more about PTMs related to PHF7 Antibody (NBP2-49628).

Blogs on PHF7

There are no specific blogs for PHF7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF7