Home » PHF7 » PHF7 Antibodies » PHF7 Antibody

PHF7 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: PHF7 Antibody [NBP2-49628] - Staining of human cell line HaCaT shows localization to nuclear speckles & the Golgi apparatus.
Immunocytochemistry/ Immunofluorescence: PHF7 Antibody [NBP2-49628] - Staining of human cell line HaCaT shows localization to nuclear speckles & the Golgi apparatus.
Immunohistochemistry-Paraffin: PHF7 Antibody [NBP2-49628] - Staining of human testis shows moderate nuclear positivity.
Immunohistochemistry-Paraffin: PHF7 Antibody [NBP2-49628] - Staining of human prostate shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PHF7 Antibody [NBP2-49628] - Staining in human testis and prostate tissues using anti-PHF7 antibody. Corresponding PHF7 RNA-seq data are presented for the ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

PHF7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IHIPDRDAAWELEPGAFSDLYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEE
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHF7 Recombinant Protein Antigen (NBP2-49628PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHF7 Antibody

  • DKFZp434L1850
  • HSPC045
  • HSPC226
  • MGC26088
  • NYD-SP6
  • PHD finger protein 7
  • Testis development protein NYD-SP6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Nudel Antibody
(OTI5E11)
NBP2-01086
Flow Cytometry: Nudel Antibody (5E11) [NBP2-01086] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Nudel antibody, and then analyzed by flow cytometry.
Western Blot: Nudel Antibody (5E11) [NBP2-01086] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Nudel (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Nudel.
Immunohistochemistry-Paraffin: Nudel Antibody (5E11) [NBP2-01086] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-Nudel mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SCF/c-kit Ligand
[Unconjugated]
255-SC/CF
1 μg/lane of Recombinant Human SCF/c-kit Ligand was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 19 kDa.
Recombinant Human SCF/c-kit Ligand (Catalog # 255-SC/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is 1-5 ng/mL.
(160 Publications)
Species: Hu
Applications: BA
TATA Element
Modulatory Factor 1 A ...
NBP1-90117
Immunocytochemistry/Immunofluorescence: TATA Element Modulatory Factor 1 Antibody [NBP1-90117] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.
Western Blot: TATA Element Modulatory Factor 1 Antibody [NBP1-90117] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: TATA Element Modulatory Factor 1 Antibody [NBP1-90117] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TMF1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
SPATA5 Antibody
NBP2-38302
Immunocytochemistry/Immunofluorescence: SPATA5 Antibody [NBP2-38302] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SPATA5 Antibody [NBP2-38302] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: SPATA5 Antibody [NBP2-38302] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SPATA9 Antibody
NBP1-83493
Western Blot: SPATA9 Antibody [NBP1-83493] - Analysis in control (vector only transfected HEK293T lysate) and SPATA9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SPATA9 Antibody [NBP1-83493] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferous ducts.
Immunocytochemistry/Immunofluorescence: SPATA9 Antibody [NBP1-83493] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Representative Western blot showing M-track protein protein proximity signals obtained for Kic1. Hog1-protA-H3: background control, Nup2: positive control. Below: Proximity signals. n = 3 replicates per sample except when indicated differently. Ratios are log2-transformed. Black lines indicate average proximity signal. Proximity signals that differ significantly from background are marked in green (q 0.01) filled circles. Grey filled triangles: q > 0.05. N: N-terminal HKMTmyc fusion. Image collected and cropped by CiteAb from the following publication (https://biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0381-z), licensed under a CC-BY licence.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Analysis of Histone H3 K9-me3 in HeLa histone lysates. Observed molecular weight is ~15 kDa.
(2 Reviews)
(23 Publications)
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Nav1.5 Antibody
(4G8:1G7)
NB110-61010
Flow Cytometry: Nav1.5 Antibody (4G8:1G7) [NB110-61010] - An intracellular stain was performed on MG-63 cells with Nav1.5 Antibody [4G8:1G7] NB110-61010PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: Nav1.5 Antibody (4G8:1G7) [NB110-61010] - An intracellular stain was performed on U2OS cells with Nav1.5 Antibody [4G8:1G7] NB110-61010PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Immunocytochemistry/Immunofluorescence: Nav1.5 Antibody (4G8-1G7) [NB110-61010] - Figure A: Plasma membrane localisation of Nav1.5 identified by 4G8:1G7 detected by anti-mouse Alexa Fluor-488 conjugated antibody; Figure B, DAP1 co-staining of cell nuclei
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
NEK1 Antibody
NBP1-82883
Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82883] - Staining of human Fallopian tube shows strong cytoplasmic/ membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82883] - Staining of human endometrium shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82883] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Klotho
[Unconjugated]
5334-KL
Klotho [Unconjugated]
(19 Publications)
Species: Hu
Applications: BA
Rab7a Antibody
NBP1-87174
Immunocytochemistry/Immunofluorescence: Rab7a Antibody [NBP1-87174] - Staining of human cell line U-251MG shows positivity in vesicles. Antibody staining is shown in green.
Western Blot: Rab7a Antibody [NBP1-87174] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Rab7a Antibody [NBP1-87174] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
RTEL1 Antibody -
BSA Free
NBP2-22360
Immunocytochemistry/Immunofluorescence: RTEL1 Antibody [NBP2-22360] - RTEL1 antibody was tested in Hela cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Western Blot: RTEL1 Antibody [NBP2-22360] - WB analysis of RTEL1 in mouse testis lysate.
Western Blot: RTEL1 Antibody [NBP2-22360] - WB analysis of RTEL1 in HeLa cell lysate.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Patched 2/PTCH2
Antibody - (First Ext ...
AF4078
Patched 2 was detected in immersion fixed paraffin-embedded sections of human basal cell carcinoma using 3 µg/mL Goat Anti-Human Patched 2 (First Extracellular Loop) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4078) overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of keratinocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
WS‑1 human fetal skin fibroblast cell line was stained with Human Patched 2 (First Extracellular Loop) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF4078, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
HIST1H4I GST (N-Term) ...
H00008294-P01
SDS-Page: Recombinant Human HIST1H4I Protein [H00008294-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Histone H4 [p
Ser1] Antibody - BSA
NB21-2000
Western Blot: Histone H4 [p Ser1] Antibody [NB21-2000] - Analysis of Histone H4 pS1 in HeLa histone prep.
Immunocytochemistry/Immunofluorescence: Histone H4 [p Ser1] Antibody [NB21-2000] - Histone H4 pS1 antibody was tested in in nonmitotic, prophase, and telophase HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunocytochemistry/Immunofluorescence: Histone H4 [p Ser1] Antibody [NB21-2000] - Histone H4 pS1 antibody was tested in nonmitotic and telophase HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red)
(3 Publications)
Species: Hu, Ma, Mu, Rt
Applications: ChIP, DB, ICC/IF, WB
PKC mu Antibody
NBP1-87789
Immunocytochemistry/Immunofluorescence: PKC mu Antibody [NBP1-87789] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PKC mu Antibody [NBP1-87789] - Staining of human parathyroid gland shows cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody (NB100-689).
Simple Western: COX-2 Antibody [NB100-689] - Simple Western lane view shows a specific band for COX2 in 1.0 mg/ml of Rat Brain at an antibody concentration of 1:100. This experiment was performed under reducing conditions using the 12-230 kDa separation system. Image provided through customer review.
(1 Review)
(31 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Recombinant Human
PPM1M GST (N-Term) Pr ...
H00132160-Q01
SDS-Page: Recombinant Human PPM1M Protein [H00132160-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
CLCA2 Antibody
NBP2-33482
Immunocytochemistry/Immunofluorescence: CLCA2 Antibody [NBP2-33482] - Staining of human cell line HaCaT shows localization to nucleus & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CLCA2 Antibody [NBP2-33482] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: CLCA2 Antibody [NBP2-33482] - Staining of human cervix, uterine shows strong membranous positivity in squamous epithelial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
XRCC2 Antibody
NBP2-98957
Immunocytochemistry/Immunofluorescence: XRCC2 Antibody [NBP2-98957] - Immunofluorescence staining of XRCC2 in HeLa cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-Human XRCC2 polyclonal antibody (dilution ratio 1:1000) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG secondary antibody (green). Positive staining was localized to Nucleus.
Western Blot: XRCC2 Antibody [NBP2-98957] - Anti-XRCC2 rabbit polyclonal antibody at 1:500 dilution. Lane A: HeLa Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 32 kDa. Observed band size: 32 kDa
Species: Hu
Applications: ICC/IF, IHC, IP, RIA, WB

Publications for PHF7 Antibody (NBP2-49628) (0)

There are no publications for PHF7 Antibody (NBP2-49628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF7 Antibody (NBP2-49628) (0)

There are no reviews for PHF7 Antibody (NBP2-49628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PHF7 Antibody (NBP2-49628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF7 Products

Bioinformatics Tool for PHF7 Antibody (NBP2-49628)

Discover related pathways, diseases and genes to PHF7 Antibody (NBP2-49628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF7 Antibody (NBP2-49628)

Discover more about diseases related to PHF7 Antibody (NBP2-49628).
 

Pathways for PHF7 Antibody (NBP2-49628)

View related products by pathway.

PTMs for PHF7 Antibody (NBP2-49628)

Learn more about PTMs related to PHF7 Antibody (NBP2-49628).

Blogs on PHF7

There are no specific blogs for PHF7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PHF7