SPATA5 Antibody

Images

 
Western Blot: SPATA5 Antibody [NBP2-38302] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: SPATA5 Antibody [NBP2-38302] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SPATA5 Antibody [NBP2-38302] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPATA5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNEQLT
Specificity
Specificity of human SPATA5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPATA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPATA5 Antibody

  • AFG2ATPase family gene 2 homolog
  • ATPase family protein 2 homolog
  • SPAFspermatogenesis associated factor SPAF
  • spermatogenesis associated 5
  • Spermatogenesis-associated factor protein
  • spermatogenesis-associated protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89215
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1483
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, PLA
NB110-40591
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-87466
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45881
Species: Hu
Applications: WB, Flow, IHC, IF
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-43772
Species: Hu
Applications: WB, IHC, IHC-P
NB120-11929
Species: Hu, Mu
Applications: WB, Flow
NB600-586
Species: Hu, Mu, Ca
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-38302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SPATA5 Antibody (NBP2-38302) (0)

There are no publications for SPATA5 Antibody (NBP2-38302).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPATA5 Antibody (NBP2-38302) (0)

There are no reviews for SPATA5 Antibody (NBP2-38302). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPATA5 Antibody (NBP2-38302) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPATA5 Products

Bioinformatics Tool for SPATA5 Antibody (NBP2-38302)

Discover related pathways, diseases and genes to SPATA5 Antibody (NBP2-38302). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPATA5 Antibody (NBP2-38302)

Discover more about diseases related to SPATA5 Antibody (NBP2-38302).

Blogs on SPATA5

There are no specific blogs for SPATA5, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPATA5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPATA5
Uniprot
COVID-19 update