PHF7 Antibody - BSA Free

Immunohistochemistry-Paraffin: PHF7 Antibody [NBP1-81674] - Staining of human prostate shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: PHF7 Antibody [NBP1-81674] - staining of human testis shows moderate cytoplasmic positivity in spermatozoa and spermatocytes.

Immunohistochemistry-Paraffin: PHF7 Antibody [NBP1-81674] - Staining in human testis and prostate tissues using anti-PHF7 antibody. Corresponding PHF7 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PHF7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PHF7 Antibody - BSA Free (NBP1-81674) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KTVKEKKECQRLRKSAKTRRVTQRKPSSGPVCWLCLREPGDPEKLGEFLQKDNISVHYFCLILSSKLPQRGQSNRGFHGFLPEDIKKEAARASRKICFVC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHF7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
• Control Peptide:

  PHF7 Protein (NBP1-81674PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PHF7 Antibody - BSA Free

• DKFZp434L1850
• HSPC045
• HSPC226
• MGC26088
• NYD-SP6
• PHD finger protein 7
• Testis development protein NYD-SP6

Background

Spermatogenesis is a complex process regulated by extracellular and intracellular factors as well as cellular interactions among interstitial cells of the testis, Sertoli cells, and germ cells. In the testis, this gene is expressed in Sertoli cells but not germ cells. However, this gene is not expressed in a patient who exhibited spermatogenic arrest at the spermatocyte stage. Spermatogenic arrest is an interruption of germ cell differentiation that may result in oligospermia or azoospermia. The proteins encoded by this gene contain plant homeodomain (PHD) finger domains, also known as leukemia associated protein (LAP) domains, believed to be involved in transcriptional regulation. Thus this protein, which localizes to the nucleus of transfected cells, has been implicated in the transcriptional regulation of spermatogenesis. Two protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHF7