PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free

Analysis in human cell line HeLa.

Staining of human cerebellum shows strong cytoplasmic/membranous granular positivity in Purkinje cells and molecular layer cells.

Staining of human pancreas shows strong cytoplasmic/membranous positivity in exocrine glandular cells and moderate cytoplasmic/membranous positivity in endocrine glandular cells.

Staining of human cerebral cortex shows strong cytoplasmic membranous/granular positivity in neurons.

Staining of human placenta shows strong cytoplasmic/membranous positivity in trophoblastic cells and decidual cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P4HTM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PHD4/HIF Prolyl Hydroxylase 4 Protein (NBP1-83989PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PHD4/HIF Prolyl Hydroxylase 4 Antibody - BSA Free

• EC 1.14.11.-
• EGLN4
• HIFPH4
• HIF-PH4
• HIF-prolyl hydroxylase 4
• HPH-4
• hypoxia-inducible factor prolyl 4-hydroxylase
• Hypoxia-inducible factor prolyl hydroxylase 4
• P4H with transmembrane domain
• P4H-TMFLJ20262
• PH4 hypoxia inducible factor prolyl 4 hydroxylase
• PH-4
• PHD4
• proline 4-hydroxylase
• prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum)
• Prolyl hydroxlase domain-containing 4
• transmembrane prolyl 4-hydroxylase

Background

Prolyl hydroxylase 4 is a prolyl hydroxylase that modifies HIF-alpha. Classic prolyl hydroxylases are found in the endoplasmic reticulum and modify collagen, whereas HIF is an intracellular protein and the prolyl hydroxylase sites do not resemble those modifying collagen. HIF is a transcriptional complex that plays a critical role in oxygen homeostasis. Prolyl hydroxylase is an essential component of the pathway through which cells sense oxygen. In the presence of oxygen, prolyl hydroxylases convert specific prolyl residues in HIF-alpha to hydroxyproline, leading to HIF-alpha destruction. Low oxygen levels, sensed at the cellular level, cause the HIF conversion to be reduced so that HIF is stable and there is increased angiogenesis. Prolyl hydroxylase 4, specifically, catalyzes the post-translational formation of 4-hydroxyproline in HIF alpha proteins. It may function as a cellular oxygen sensor and, under normoxic conditions, may targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitylation complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: P4HTM