PGLS Antibody

Images

 
Western Blot: PGLS Antibody [NBP1-56387] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: PGLS Antibody [NBP1-56387] - Human Tonsil.
Immunohistochemistry-Paraffin: PGLS Antibody [NBP1-56387] - Human Colon Tissue, antibody concentration 5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGLS Antibody Summary

Immunogen
Synthetic peptides corresponding to PGLS(6-phosphogluconolactonase) The peptide sequence was selected from the middle region of PGLS. Peptide sequence AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGLS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against PGLS and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PGLS Antibody

  • 6PGLEC 3.1.1.31
  • 6-phosphogluconolactonase

Background

PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65802
Species: Hu
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-71840
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86632
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24940
Species: Hu, Ye
Applications: WB
NBP1-31333
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
AF2538
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-65328
Species: Hu
NBP1-97492
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, GP, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PGLS Antibody (NBP1-56387) (0)

There are no publications for PGLS Antibody (NBP1-56387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGLS Antibody (NBP1-56387) (0)

There are no reviews for PGLS Antibody (NBP1-56387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGLS Antibody (NBP1-56387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PGLS Antibody (NBP1-56387)

Discover related pathways, diseases and genes to PGLS Antibody (NBP1-56387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGLS Antibody (NBP1-56387)

Discover more about diseases related to PGLS Antibody (NBP1-56387).
 

Pathways for PGLS Antibody (NBP1-56387)

View related products by pathway.

Blogs on PGLS

There are no specific blogs for PGLS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGLS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGLS
Uniprot