PGD Antibody - BSA Free

Immunohistochemistry-Paraffin: PGD Antibody [NBP2-58686] - Staining in human esophagus and skeletal muscle tissues using anti-PGD antibody. Corresponding PGD RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PGD Antibody [NBP2-58686] - Staining of human esophagus, liver, lymph node and testis using Anti-PGD antibody NBP2-58686 (A) shows similar protein distribution across tissues to independent antibody NBP1-85925 (B).

Western Blot: PGD Antibody [NBP2-58686] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.

Immunocytochemistry/Immunofluorescence: PGD Antibody [NBP2-58686] - Staining of human cell line A549 shows localization to cytosol & intermediate filaments.

Immunohistochemistry-Paraffin: PGD Antibody [NBP2-58686] - Staining of human lymph node.

Immunohistochemistry-Paraffin: PGD Antibody [NBP2-58686] - Staining of human esophagus shows high expression.

Immunohistochemistry-Paraffin: PGD Antibody [NBP2-58686] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: PGD Antibody [NBP2-58686] - Staining of human testis.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PGD Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PGD Antibody - BSA Free (NBP2-58686) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEI
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PGD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. IHC-P, Retrieval method: HIER pH6.
• Control Peptide:

  PGD Recombinant Protein Antigen (NBP2-58686PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PGD Antibody - BSA Free

• 6PGD
• EC 1.1.1.44,6-phosphogluconate dehydrogenase, decarboxylating
• PGD
• PGDH
• phosphogluconate dehydrogenase

Background

6-phosphogluconate dehydrogenase is the second dehydrogenase in the pentose phosphate shunt. Deficiency of this enzyme is generally asymptomatic, and the inheritance of this disorder is autosomal dominant. Hemolysis results from combined deficiency of 6-phosphogluconate dehydrogenase and 6-phosphogluconolactonase suggesting a synergism of the two enzymopathies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PGD