Recombinant Human PGC-1 beta Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PGC-1 beta Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 914 - 1023 of Human PPARGC1B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPARGC1B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PGC-1 beta Protein

  • DKFZp686C1790
  • ERRL1
  • PERCFLJ14284
  • peroxisome proliferator-activated receptor gamma, coactivator 1 beta
  • PGC1
  • PGC1Bgamma, coactivator 1, beta
  • PPARGC1

Background

PPARGC1B - peroxisome proliferative activated receptor, gamma, coactivator 1, beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-55915
Species: Hu
Applications: WB, ICC/IF
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-91012
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP

Publications for PGC-1 beta Partial Recombinant Protein (H00133522-Q01) (0)

There are no publications for PGC-1 beta Partial Recombinant Protein (H00133522-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGC-1 beta Partial Recombinant Protein (H00133522-Q01) (0)

There are no reviews for PGC-1 beta Partial Recombinant Protein (H00133522-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGC-1 beta Partial Recombinant Protein (H00133522-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PGC-1 beta Products

Bioinformatics Tool for PGC-1 beta Partial Recombinant Protein (H00133522-Q01)

Discover related pathways, diseases and genes to PGC-1 beta Partial Recombinant Protein (H00133522-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGC-1 beta Partial Recombinant Protein (H00133522-Q01)

Discover more about diseases related to PGC-1 beta Partial Recombinant Protein (H00133522-Q01).
 

Pathways for PGC-1 beta Partial Recombinant Protein (H00133522-Q01)

View related products by pathway.

PTMs for PGC-1 beta Partial Recombinant Protein (H00133522-Q01)

Learn more about PTMs related to PGC-1 beta Partial Recombinant Protein (H00133522-Q01).
 

Research Areas for PGC-1 beta Partial Recombinant Protein (H00133522-Q01)

Find related products by research area.

Blogs on PGC-1 beta

There are no specific blogs for PGC-1 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PGC-1 beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPARGC1B