PGC-1 beta Antibody - Azide and BSA Free

Western Blot: PGC-1 beta Antibody [NBP2-94238] - Analysis of extracts of various cell line, using PGC-1 beta .Exposure time: 5min.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PGC-1 beta Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 850-950 of human PGC1 beta (NP_001166170.1). SSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPARGC1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PGC-1 beta Antibody - Azide and BSA Free

• DKFZp686C1790
• ERRL1
• PERCFLJ14284
• peroxisome proliferator-activated receptor gamma, coactivator 1 beta
• PGC1
• PGC1Bgamma, coactivator 1, beta
• PPARGC1

Background

PGC-1 beta is a tissue specific co-activator that enhances the activity of estrogen receptor alpha. The co-activation function relies on a bipartite transcriptional activation domain and two LXXLL motifs that interact with the AR2 domain of ER-alpha in an estrogen-dependent manner. PGC-1 beta is also involved in activation of nuclear respiratory factor 1 (NRF1) and glucocorticoid receptor in the presence of glucocorticoids. Ectopic expression of this protein has been shown to lead to increased mitochondrial numbers and basal oxygen consumption.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: PPARGC1B