PFKP Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PFKP Antibody - BSA Free (NBP2-58537) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PFKP |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PFKP Antibody - BSA Free
Background
The PFKP gene encodes the platelet isoform of phosphofructokinase (PFK) (ATP:D-fructose-6-phosphate-1-phosphotransferase, EC 2.7.1.11). PFK catalyzes the irreversible conversion of fructose-6-phosphate to fructose-1,6-bisphosphate and is a key regulatory enzyme in glycolysis. The PFKP gene, which maps to chromosome 10p, is also expressed in fibroblasts. See also the muscle (PFKM; MIM 610681) and liver (PFKL; MIM 171860) isoforms of phosphofructokinase, which map to chromosomes 12q13 and 21q22, respectively. Vora (1981) [PubMed 6451249] determined that full tetrameric phophofructokinase enzyme expressed in platelets can be composed of subunits P4, P3L, and P2L2.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: BA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Hu, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Publications for PFKP Antibody (NBP2-58537) (0)
There are no publications for PFKP Antibody (NBP2-58537).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PFKP Antibody (NBP2-58537) (0)
There are no reviews for PFKP Antibody (NBP2-58537).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PFKP Antibody (NBP2-58537) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PFKP Products
Research Areas for PFKP Antibody (NBP2-58537)
Find related products by research area.
|
Blogs on PFKP