PFKP Antibody

Images

 
Western Blot: PFKP Antibody [NBP2-58537] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: PFKP Antibody [NBP2-58537] - Staining of human cell line MCF7 shows localization to cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PFKP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINV
Specificity
Specificity of human PFKP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PFKP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
PFKP Knockout HeLa Cell Lysate
Control Peptide
PFKP Recombinant Protein Antigen (NBP2-58537PEP)

Reactivity Notes

Mouse 85%, Rat 87%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PFKP Antibody

  • 6-phosphofructokinase type C
  • 6-phosphofructokinase, platelet type
  • EC 2.7.1
  • EC 2.7.1.11
  • PFK-CFLJ40226
  • PFKFplatelet type
  • Phosphofructokinase 1
  • phosphofructokinase, platelet
  • phosphohexokinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75578
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NBP1-56607
Species: Hu, Mu
Applications: WB
423-F8/CF
Species: Hu, Mu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Ch, Pm
Applications: WB, IB, IHC
NBP2-78736
Species: Hu
NBP1-51643
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P, KD
NBP2-67503
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KD, KO, LA
NBP1-33144
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-48336
Species: Hu, Mu, Po, Bv
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-48308
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-81251
Species: Hu, Mu
Applications: Simple Western, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
NBP2-58537
Species: Hu
Applications: WB, ICC/IF

Publications for PFKP Antibody (NBP2-58537) (0)

There are no publications for PFKP Antibody (NBP2-58537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PFKP Antibody (NBP2-58537) (0)

There are no reviews for PFKP Antibody (NBP2-58537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PFKP Antibody (NBP2-58537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PFKP Products

Bioinformatics Tool for PFKP Antibody (NBP2-58537)

Discover related pathways, diseases and genes to PFKP Antibody (NBP2-58537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PFKP Antibody (NBP2-58537)

Discover more about diseases related to PFKP Antibody (NBP2-58537).
 

Pathways for PFKP Antibody (NBP2-58537)

View related products by pathway.

PTMs for PFKP Antibody (NBP2-58537)

Learn more about PTMs related to PFKP Antibody (NBP2-58537).
 

Research Areas for PFKP Antibody (NBP2-58537)

Find related products by research area.

Blogs on PFKP

There are no specific blogs for PFKP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PFKP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PFKP