PF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PF1 Antibody [NBP1-89599] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PF1 Antibody [NBP1-89599] - Staining of human prostate shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGAVNMCYRTLYIGTGADMDVCLTNYGHCNYVSGKHACIFYDENTKHYELLNYSEHGTTVDNVLYSCDFSEKTPPTPPSSIVAKVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PF1 Protein (NBP1-89599PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PF1 Antibody

  • FLJ34122
  • KIAA1523MGC131914
  • PF1
  • PHD factor 1
  • PHD finger protein 12
  • PHD zinc finger transcription factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
49130002
Species: Ce
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
795-P4/CF
Species: Hu
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-86724
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90069
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
374-EA
Species: Hu
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for PF1 Antibody (NBP1-89599) (0)

There are no publications for PF1 Antibody (NBP1-89599).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PF1 Antibody (NBP1-89599) (0)

There are no reviews for PF1 Antibody (NBP1-89599). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PF1 Antibody (NBP1-89599) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PF1 Products

Bioinformatics Tool for PF1 Antibody (NBP1-89599)

Discover related pathways, diseases and genes to PF1 Antibody (NBP1-89599). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PF1 Antibody (NBP1-89599)

Discover more about diseases related to PF1 Antibody (NBP1-89599).
 

Pathways for PF1 Antibody (NBP1-89599)

View related products by pathway.

PTMs for PF1 Antibody (NBP1-89599)

Learn more about PTMs related to PF1 Antibody (NBP1-89599).

Blogs on PF1

There are no specific blogs for PF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF12