PEX11B Antibody

Images

 
Western Blot: PEX11B Antibody [NBP2-13750] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: PEX11B Antibody [NBP2-13750] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEX11B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAY EIRLLMEQESSACSRRLKGSGGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX11B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PEX11B Protein (NBP2-13750PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX11B Antibody

  • peroxin-11B
  • peroxisomal biogenesis factor 11 beta
  • Peroxisomal biogenesis factor 11Bperoxisomal membrane protein 11B
  • PEX11-beta
  • Protein PEX11 homolog beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59704
Species: Hu
Applications: WB
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-49620
Species: Hu
Applications: IHC
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NBP2-01512
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-49881
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59745
Species: Hu
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-85828
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13750
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PEX11B Antibody (NBP2-13750) (0)

There are no publications for PEX11B Antibody (NBP2-13750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX11B Antibody (NBP2-13750) (0)

There are no reviews for PEX11B Antibody (NBP2-13750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX11B Antibody (NBP2-13750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PEX11B Products

Bioinformatics Tool for PEX11B Antibody (NBP2-13750)

Discover related pathways, diseases and genes to PEX11B Antibody (NBP2-13750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX11B Antibody (NBP2-13750)

Discover more about diseases related to PEX11B Antibody (NBP2-13750).
 

Pathways for PEX11B Antibody (NBP2-13750)

View related products by pathway.

PTMs for PEX11B Antibody (NBP2-13750)

Learn more about PTMs related to PEX11B Antibody (NBP2-13750).

Blogs on PEX11B

There are no specific blogs for PEX11B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX11B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX11B