PEX10 Antibody

Images

 
Immunohistochemistry: PEX10 Antibody [NBP2-48945] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEX10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQK
Specificity
Specificity of human PEX10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PEX10 Recombinant Protein Antigen (NBP2-48945PEP)

Reactivity Notes

Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX10 Antibody

  • NALD
  • peroxin 10
  • peroxin-10
  • peroxisomal biogenesis factor 10MGC1998
  • Peroxisome assembly protein 10
  • RING finger protein 69
  • RNF69peroxisome biogenesis factor 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49599
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
8090-ZN
Species: Hu
NBP1-80577
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87185
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005195-B01P
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-65021
Species: Hu
NBP2-46476
Species: Hu
Applications: WB, IHC
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86321
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP1-59705
Species: Hu
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85828
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-48945
Species: Hu
Applications: IHC, IHC-P

Publications for PEX10 Antibody (NBP2-48945) (0)

There are no publications for PEX10 Antibody (NBP2-48945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX10 Antibody (NBP2-48945) (0)

There are no reviews for PEX10 Antibody (NBP2-48945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PEX10 Antibody (NBP2-48945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PEX10 Antibody (NBP2-48945)

Discover related pathways, diseases and genes to PEX10 Antibody (NBP2-48945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX10 Antibody (NBP2-48945)

Discover more about diseases related to PEX10 Antibody (NBP2-48945).
 

Pathways for PEX10 Antibody (NBP2-48945)

View related products by pathway.

PTMs for PEX10 Antibody (NBP2-48945)

Learn more about PTMs related to PEX10 Antibody (NBP2-48945).
 

Research Areas for PEX10 Antibody (NBP2-48945)

Find related products by research area.

Blogs on PEX10

There are no specific blogs for PEX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX10