PEX10 Antibody


Immunohistochemistry: PEX10 Antibody [NBP2-48945] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

PEX10 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQK
Specificity of human PEX10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PEX10 Recombinant Protein Antigen (NBP2-48945PEP)

Reactivity Notes

Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PEX10 Antibody

  • NALD
  • peroxin 10
  • peroxin-10
  • peroxisomal biogenesis factor 10MGC1998
  • Peroxisome assembly protein 10
  • RING finger protein 69
  • RNF69peroxisome biogenesis factor 10


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for PEX10 Antibody (NBP2-48945) (0)

There are no publications for PEX10 Antibody (NBP2-48945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX10 Antibody (NBP2-48945) (0)

There are no reviews for PEX10 Antibody (NBP2-48945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PEX10 Antibody (NBP2-48945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PEX10 Antibody (NBP2-48945)

Discover related pathways, diseases and genes to PEX10 Antibody (NBP2-48945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX10 Antibody (NBP2-48945)

Discover more about diseases related to PEX10 Antibody (NBP2-48945).

Pathways for PEX10 Antibody (NBP2-48945)

View related products by pathway.

PTMs for PEX10 Antibody (NBP2-48945)

Learn more about PTMs related to PEX10 Antibody (NBP2-48945).

Research Areas for PEX10 Antibody (NBP2-48945)

Find related products by research area.

Blogs on PEX10

There are no specific blogs for PEX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PEX10 Antibody and receive a gift card or discount.


Gene Symbol PEX10