PERP Antibody

Images

 
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human skin shows moderate positivity in stratum corneum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PERP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PERP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PERP Protein (NBP1-85173PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PERP Antibody

  • dJ496H19.1
  • KCP1KCP-1
  • Keratinocyte-associated protein 1
  • KRTCAP11110017A08Rik
  • p53 apoptosis effector related to PMP22
  • p53 apoptosis effector related to PMP-22
  • P53-induced protein PIGPC1
  • PERP, TP53 apoptosis effector
  • PIGPC1RP3-496H19.1
  • THWkeratinocytes associated protein 1
  • Transmembrane protein THW

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59438
Species: Hu
Applications: WB, ELISA, IHC
H00007348-M05
Species: Hu
Applications: WB, ELISA
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85173
Species: Hu
Applications: IHC, IHC-P

Publications for PERP Antibody (NBP1-85173) (0)

There are no publications for PERP Antibody (NBP1-85173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PERP Antibody (NBP1-85173) (0)

There are no reviews for PERP Antibody (NBP1-85173). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PERP Antibody (NBP1-85173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PERP Products

Bioinformatics Tool for PERP Antibody (NBP1-85173)

Discover related pathways, diseases and genes to PERP Antibody (NBP1-85173). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PERP Antibody (NBP1-85173)

Discover more about diseases related to PERP Antibody (NBP1-85173).
 

Pathways for PERP Antibody (NBP1-85173)

View related products by pathway.

PTMs for PERP Antibody (NBP1-85173)

Learn more about PTMs related to PERP Antibody (NBP1-85173).
 

Research Areas for PERP Antibody (NBP1-85173)

Find related products by research area.

Blogs on PERP

There are no specific blogs for PERP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PERP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PERP