PERP Antibody


Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human esophagus shows very weak membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Analysis in human skin and skeletal muscle tissues. Corresponding PERP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human skin shows moderate to strong membranous positivity in stratum corneum.
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human lymph node shows no positivity as expected.
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human endometrium shows no positivity as expected.
Immunohistochemistry-Paraffin: PERP Antibody [NBP1-85173] - Staining of human skeletal muscle shows no positivity as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

PERP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW
Specificity of human PERP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PERP Protein (NBP1-85173PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PERP Antibody

  • dJ496H19.1
  • KCP1KCP-1
  • Keratinocyte-associated protein 1
  • KRTCAP11110017A08Rik
  • p53 apoptosis effector related to PMP22
  • p53 apoptosis effector related to PMP-22
  • P53-induced protein PIGPC1
  • PERP, TP53 apoptosis effector
  • PIGPC1RP3-496H19.1
  • THWkeratinocytes associated protein 1
  • Transmembrane protein THW


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IF
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for PERP Antibody (NBP1-85173) (0)

There are no publications for PERP Antibody (NBP1-85173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PERP Antibody (NBP1-85173) (0)

There are no reviews for PERP Antibody (NBP1-85173). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PERP Antibody (NBP1-85173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PERP Antibody (NBP1-85173)

Discover related pathways, diseases and genes to PERP Antibody (NBP1-85173). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PERP Antibody (NBP1-85173)

Discover more about diseases related to PERP Antibody (NBP1-85173).

Pathways for PERP Antibody (NBP1-85173)

View related products by pathway.

PTMs for PERP Antibody (NBP1-85173)

Learn more about PTMs related to PERP Antibody (NBP1-85173).

Research Areas for PERP Antibody (NBP1-85173)

Find related products by research area.

Blogs on PERP

There are no specific blogs for PERP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PERP Antibody and receive a gift card or discount.


Gene Symbol PERP