Peroxiredoxin 4 Antibody (9E7V0)

Western Blot: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Western blot analysis of extracts of various cell lines, using Peroxiredoxin 4 (PRDX4) Rabbit mAb (NBP3-16760) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunocytochemistry/Immunofluorescence: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunofluorescence analysis of NIH-3T3 cells using Peroxiredoxin 4 (PRDX4) Rabbit mAb (NBP3-16760) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded human cervix cancer tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded mouse testis tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunofluorescence analysis of NIH-3T3 cells using Peroxiredoxin 4 (PRDX4) Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded human liver tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded human thyroid cancer tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded human lung cancer tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded rat colon tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Peroxiredoxin 4 Antibody (9E7V0) [NBP3-16760] - Immunohistochemistry analysis of Peroxiredoxin 4 in paraffin-embedded human colon carcinoma tissue using Peroxiredoxin 4 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 9E7V0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Peroxiredoxin 4 Antibody (9E7V0) Summary

• Description: Novus Biologicals Rabbit Peroxiredoxin 4 Antibody (9E7V0) (NBP3-16760) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 4 (PRDX4) (Q13162). MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PRDX4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Peroxiredoxin 4 Antibody (9E7V0)

• Antioxidant enzyme AOE372
• AOE372
• AOE37-2PRX-4
• EC 1.11.1.15
• Peroxiredoxin 4
• Peroxiredoxin IV
• peroxiredoxin-4
• PRDX4
• Prx4
• prx-4
• prx-IV
• thioredoxin peroxidase (antioxidant enzyme)
• Thioredoxin peroxidase AO372
• Thioredoxin-dependent peroxide reductase A0372

Background

Peroxiredoxin-4 is encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRDX4