PEO1 Antibody

Images

 
Western Blot: PEO1 Antibody [NBP1-57356] - Sample Tissue: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate ...read more
Western Blot: PEO1 Antibody [NBP1-57356] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEO1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PEO1 The peptide sequence was selected from the middle region of PEO1. Peptide sequence GVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLIL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TWNK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PEO1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PEO1 Antibody

  • ATXN8
  • chromosome 10 open reading frame 2
  • EC 3.6.4.12
  • FLJ21832
  • infantile onset spinocerebellar ataxia (autosomal recessive)
  • IOSCA
  • mitochondrial
  • MTDPS7
  • PEO1PEOA3
  • TWINKLE

Background

Twinkle is a mitochondrial protein with structural similarity to the phage T7 primase/helicase (GP4) and other hexameric ring helicases. The twinkle protein colocalizes with mtDNA in mitochondrial nucleoids, and its name derives from the unusual localization pattern reminiscent of twinkling stars.Twinkle is a mitochondrial protein with structural similarity to the phage T7 primase/helicase (GP4) and other hexameric ring helicases. The twinkle protein colocalizes with mtDNA in mitochondrial nucleoids, and its name derives from the unusual localization pattern reminiscent of twinkling stars (Spelbrink et al., 2001 [PubMed 11431692]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-213 BG473173.1 6-218 214-1706 BX640829.1 215-1707 1707-3630 BC033762.1 719-2642

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52300
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005498-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, RNAi, S-ELISA
NBP1-90065
Species: Hu
Applications: IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-42657
Species: Hu
Applications: IP (-), WB
NB100-2737
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
MAB7265
Species: Mu
Applications: WB, IHC
NBP1-90044
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PEO1 Antibody (NBP1-57356) (0)

There are no publications for PEO1 Antibody (NBP1-57356).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEO1 Antibody (NBP1-57356) (0)

There are no reviews for PEO1 Antibody (NBP1-57356). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEO1 Antibody (NBP1-57356) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PEO1 Products

Bioinformatics Tool for PEO1 Antibody (NBP1-57356)

Discover related pathways, diseases and genes to PEO1 Antibody (NBP1-57356). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEO1 Antibody (NBP1-57356)

Discover more about diseases related to PEO1 Antibody (NBP1-57356).
 

Pathways for PEO1 Antibody (NBP1-57356)

View related products by pathway.

PTMs for PEO1 Antibody (NBP1-57356)

Learn more about PTMs related to PEO1 Antibody (NBP1-57356).

Blogs on PEO1

There are no specific blogs for PEO1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TWNK
Uniprot