Pentraxin 3/TSG-14 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Pentraxin 3/TSG-14. Source: E. coli
Amino Acid Sequence: GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PTX3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49595. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Pentraxin 3/TSG-14 Recombinant Protein Antigen
Background
Pentraxin 3 (PTX3) is the prototypic member of the long pentraxin family sharing the C-terminal domain with short pentraxins (C-reactive protein and serum amyloid P component) and containing a unique N-terminal domain. The protein is a soluble pattern recognition receptor and represents a nonredundant component of the humoral innate immunity against selected pathogens. PTX3 is rapidly produced and released at inflammatory sites by diverse cell types including monocytes/macrophages, endothelial cells, vascular smooth muscle cells, fibroblasts, and adipocytes. It interacts with several ligands, including growth factors, extracellular matrix components and selected pathogens. PTX3 has been implicated in vascular damage, angiogenesis, atherosclerosis, and restenosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: ELISA
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Publications for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP) (0)
There are no publications for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP) (0)
There are no reviews for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP) (0)
Additional Pentraxin 3/TSG-14 Products
Research Areas for Pentraxin 3/TSG-14 Recombinant Protein Antigen (NBP2-49595PEP)
Find related products by research area.
|
Blogs on Pentraxin 3/TSG-14