PEG10 Antibody - BSA Free

Immunohistochemistry-Paraffin: PEG10 Antibody [NBP2-13749] - Analysis in human placenta and prostate tissues using Anti-PEG10 antibody. Corresponding PEG10 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: PEG10 Antibody [NBP2-13749] - Staining of human cell line Hep G2 shows localization to nucleus & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PEG10 Antibody [NBP2-13749] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: PEG10 Antibody [NBP2-13749] - Staining of human placenta shows high expression.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PEG10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PEG10 Antibody - BSA Free (NBP2-13749) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PEG10 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QCIHIERRLARAAAARKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLYCGTGGHYADNCPAKASKSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEG10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF /Permeabilization: PFA/Triton X-100.
• Control Peptide:

  PEG10 Protein (NBP2-13749PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PEG10 Antibody - BSA Free

• EDR
• embryonal carcinoma differentiation regulated
• Embryonal carcinoma differentiation-regulated protein
• HB-1
• KIAA1051EDR
• Mammalian retrotransposon-derived protein 2
• Mar2
• Mart2
• MEF3 Like 1
• MEF3L
• MEF3L1
• Myelin expression factor 3-like protein 1
• paternally expressed 10
• Paternally expressed gene 10 protein
• PEG10
• retrotransposon gag domain containing 3
• Retrotransposon gag domain-containing protein 3
• Retrotransposon-derived gag-like polyprotein
• retrotransposon-derived protein PEG10
• RGAG3
• RGAG3MEF3-like protein 1
• RTL2
• SIRH1
• Ty3/Gypsy-like protein

Background

paternally expressed 10. This gene includes two overlapping reading frames of the same transcript encoding distinct isoforms. The shorter isoform has a CCHC-type zinc finger motif containing a sequence characteristic of gag proteins of most retroviruses and some retrotransposons, and it functions in part by interacting with members of the TGF-beta receptor family. The longer isoform has the active-site DSG consensus sequence of the protease domain of pol proteins. The longer isoform is the result of -1 translational frame shifting that is also seen in some retroviruses. Expression of these two isoforms only comes from the paternal allele due to imprinting. Increased gene expression (as observed by an increase in mRNA levels) is associated with hepatocellular carcinomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PEG10 Antibody (NBP2-13749)(3)

Publications using NBP2-13749

• Komatsuda H, Nagato T, Kosaka A et al. Tumor-promoting function of paternally expressed gene 10 and its immunogenicity in inducing anti-tumor helper T cells in head and neck squamous cell carcinoma. Cancer immunology, immunotherapy : CII 2025-06-25 [PMID: 40560436]
• Shapovalova M, Lee J K et al. PEG10 Promoter-Driven Expression of Reporter Genes Enables Molecular Imaging of Lethal Prostate Cancer. Cancer Res 2019-01-11 [PMID: 31530569] (IF/IHC, Human)
  
  Details:
  Meriones unguiculatus (Mongolian gerbil)
• Kim S, Thaper D et al. PEG10 is associated with treatment-induced neuroendocrine prostate cancer. J Mol Endocrinol 2019-01-07 [PMID: 31013476] (WB, Human)

Bioinformatics

• Gene Symbol: PEG10