epsilon-Sarcoglycan Antibody

Images

 
Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml SGCE is supported by BioGPS gene expression data to be expressed in 721_B
Immunohistochemistry: SGCE Antibody [NBP1-59794] - pFA fixed human skeletal muscle tissue at an antibody concentration of 5.0 ug/ml using anti-SGCE antibody
Western Blot: SGCE Antibody [NBP1-59794] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: SGCE Antibody [NBP1-59794] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: SGCE Antibody [NBP1-59794] - Mouse cerebellum tissue, 1:500 dilution.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

epsilon-Sarcoglycan Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to SGCE(sarcoglycan, epsilon) The peptide sequence was selected from the N terminal of SGCE. Peptide sequence TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGCE
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for epsilon-Sarcoglycan Antibody

  • dystonia 11, myoclonic
  • DYT11
  • epsilon-Sarcoglycan
  • Epsilon-SG
  • ESG
  • Sarcoglycan epsilon
  • sarcoglycan, epsilon
  • SGCE

Background

SGCE is a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix. Mutations in this gene have been associated with myoclonus-dystonia syndrome. Alternative splicing results in multiple transcript variants.The SGCE gene encodes the epsilon member of the sarcoglycan family, transmembrane components of the dystrophin-glycoprotein complex, which links the cytoskeleton to the extracellular matrix.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SGCE Antibody (NBP1-59794) (0)

There are no publications for SGCE Antibody (NBP1-59794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SGCE Antibody (NBP1-59794) (0)

There are no reviews for SGCE Antibody (NBP1-59794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SGCE Antibody (NBP1-59794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our epsilon-Sarcoglycan Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGCE