We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PEDFR/PNPLA2/ATGL Recombinant Protein Antigen

Images

 
There are currently no images for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-57480PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PEDFR/PNPLA2/ATGL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEDF R/PNPLA2/ATGL.

Source: E. coli

Amino Acid Sequence: FSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PNPLA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57480.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen

  • Adipose triglyceride lipase
  • ATGL
  • ATGL1110001C14Rik
  • Calcium-independent phospholipase A2
  • Desnutrin
  • EC 3.1.1.3
  • FP17548
  • IPLA2-zeta
  • patatin-like phospholipase domain containing 2
  • patatin-like phospholipase domain-containing protein 2
  • patatin-like phospholipase domain-containing protein 2-like
  • PEDF R
  • PEDFR
  • PEDF-R
  • Pigment epithelium-derived factor
  • PNPLA2
  • Transport-secretion protein 2
  • transport-secretion protein 2.2
  • triglyceride hydrolase
  • TTS2
  • TTS2.2
  • TTS-2.2
  • TTS2DKFZp667M109

Background

Patatin-like phospholipase domain-containing protein 2 (PNPLA2), also known as adipose triglyceride lipase (ATGL), is a lipolytic enzyme required for mobilization of fatty acids from triglyceride stores in adipose tissue. Until recently, hormone-sensitive lipase (HSL) was the only enzyme known to hydrolyze triglycerides in mammalian adipose tissue. However, ATGL has now been shown to catalyze the initial step of triglyceride hydrolysis in adipocyte and non-adipocyte lipid droplets. Thus, ATGL and HSL coordinate to catabolize stored triglycerides in adipose tissue of mammals.

Defects in PNPLA2 can lead to neutral lipid storage disease with myopathy (NLSDM), a neutral lipid storage disorder with myopathy but without ichthyosis.

ATGL antibodies can serve as useful tools for adipocyte studies and research on triglyceride processing and fat storage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY1177-05
Species: Hu
Applications: ELISA
DVE00
Species: Hu
Applications: ELISA
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
H00051099-M01
Species: Bv, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB
NBP1-88502
Species: Hu
Applications: IHC,  IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP3-46465
Species: Hu, Mu
Applications: ELISA, IHC, WB
NB110-40760
Species: Fi, Hu, Mu, Po, Rt
Applications: Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-35469
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
DLP00
Species: Hu
Applications: ELISA
DTSP10
Species: Hu
Applications: ELISA
NBP2-57480PEP
Species: Hu
Applications: AC

Publications for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-57480PEP) (0)

There are no publications for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-57480PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-57480PEP) (0)

There are no reviews for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-57480PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-57480PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEDFR/PNPLA2/ATGL Products

Research Areas for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-57480PEP)

Find related products by research area.

Blogs on PEDFR/PNPLA2/ATGL

There are no specific blogs for PEDFR/PNPLA2/ATGL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PEDFR/PNPLA2/ATGL Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PNPLA2