Pea3 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 40-246 of human Pea3 (NP_001977.1).
Sequence: MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ETV4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Pea3 Antibody - BSA Free
Background
Pea3, also known as ETS translocation variant 4, is an approximately 54 kDa, 484 amino acid protein, which is involved in transcriptional activation of adenovirus E1A gene, and is regulated by ERBB2, STK11, PLAG1, CTNNB1. Studies about the Pea3 protein are being done on diseases such as ovaria, pancreatic, gastric, breast, and prostate cancers. As well as peripheral primitive neuroectodermal tumors, carcinoma, adenoma, ewings sarcoma, squamous cell carcinoma, and oral cancers. The Pea3 protein has shown interaction with Taf7, EP300, SRF, HOXD4, STK11, and involvement in the ErbB2-ErbB3 Heterodimer pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: Bind, BA
Publications for Pea3 Antibody (NBP3-35583) (0)
There are no publications for Pea3 Antibody (NBP3-35583).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Pea3 Antibody (NBP3-35583) (0)
There are no reviews for Pea3 Antibody (NBP3-35583).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Pea3 Antibody (NBP3-35583) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Pea3 Products
Research Areas for Pea3 Antibody (NBP3-35583)
Find related products by research area.
|
Blogs on Pea3