PDSS2 Antibody

Images

 
Western Blot: PDSS2 Antibody [NBP1-88739] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: PDSS2 Antibody [NBP1-88739] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: PDSS2 Antibody [NBP1-88739] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDSS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMAFQYGKH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDSS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDSS2 Protein (NBP1-88739PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDSS2 Antibody

  • All-trans-decaprenyl-diphosphate synthase subunit 2
  • bA59I9.3
  • C6orf210decaprenyl-diphosphate synthase subunit 2
  • Candidate tumor suppressor protein
  • chromosome 6 open reading frame 210
  • Decaprenyl pyrophosphate synthase subunit 2
  • decaprenyl pyrophosphate synthetase subunit 2
  • DLP1hDLP1
  • EC 2.5.1.91
  • prenyl (decaprenyl) diphosphate synthase, subunit 2
  • subunit 2 of decaprenyl diphosphate synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-85511
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-56780
Species: Hu
Applications: WB, ICC/IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-13750
Species: Hu
Applications: WB, IHC, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00054957-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-15659
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59704
Species: Hu
Applications: WB

Publications for PDSS2 Antibody (NBP1-88739) (0)

There are no publications for PDSS2 Antibody (NBP1-88739).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDSS2 Antibody (NBP1-88739) (0)

There are no reviews for PDSS2 Antibody (NBP1-88739). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDSS2 Antibody (NBP1-88739) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDSS2 Products

Bioinformatics Tool for PDSS2 Antibody (NBP1-88739)

Discover related pathways, diseases and genes to PDSS2 Antibody (NBP1-88739). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDSS2 Antibody (NBP1-88739)

Discover more about diseases related to PDSS2 Antibody (NBP1-88739).
 

Pathways for PDSS2 Antibody (NBP1-88739)

View related products by pathway.

PTMs for PDSS2 Antibody (NBP1-88739)

Learn more about PTMs related to PDSS2 Antibody (NBP1-88739).

Blogs on PDSS2

There are no specific blogs for PDSS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDSS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDSS2