PDP1/PPAPDC2 Antibody

Images

 
Western Blot: PDP1/PPAPDC2 Antibody [NBP1-83443] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunocytochemistry/ Immunofluorescence: PDP1/PPAPDC2 Antibody [NBP1-83443] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: PDP1/PPAPDC2 Antibody [NBP1-83443] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDP1/PPAPDC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PAHNQMDMFVTLSVDKYSFPSGHATRAALMSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPAPDC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDP1/PPAPDC2 Protein (NBP1-83443PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDP1/PPAPDC2 Antibody

  • bA6J24.6
  • EC 3.1.3
  • EC 3.1.3.-
  • FLJ46512
  • FLJ90191
  • MGC15483
  • PDP1
  • phosphatidic acid phosphatase type 2 domain containing 2
  • Phosphatidic acid phosphatase type 2 domain-containing protein 2
  • polyisoprenoid diphosphate phosphatase type 1
  • PPAP2 domain-containing protein 2
  • presqualene diphosphate phosphatase
  • PSDP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-82912
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
NBP2-19822
Species: Hu
Applications: WB
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87307
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83443
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDP1/PPAPDC2 Antibody (NBP1-83443) (0)

There are no publications for PDP1/PPAPDC2 Antibody (NBP1-83443).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDP1/PPAPDC2 Antibody (NBP1-83443) (0)

There are no reviews for PDP1/PPAPDC2 Antibody (NBP1-83443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDP1/PPAPDC2 Antibody (NBP1-83443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDP1/PPAPDC2 Products

Bioinformatics Tool for PDP1/PPAPDC2 Antibody (NBP1-83443)

Discover related pathways, diseases and genes to PDP1/PPAPDC2 Antibody (NBP1-83443). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDP1/PPAPDC2 Antibody (NBP1-83443)

Discover more about diseases related to PDP1/PPAPDC2 Antibody (NBP1-83443).
 

Pathways for PDP1/PPAPDC2 Antibody (NBP1-83443)

View related products by pathway.

PTMs for PDP1/PPAPDC2 Antibody (NBP1-83443)

Learn more about PTMs related to PDP1/PPAPDC2 Antibody (NBP1-83443).

Blogs on PDP1/PPAPDC2

There are no specific blogs for PDP1/PPAPDC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDP1/PPAPDC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPAPDC2