PDP1/PPAPDC2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PDP1/PPAPDC2 Antibody [NBP1-83443] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.

Immunohistochemistry-Paraffin: PDP1/PPAPDC2 Antibody [NBP1-83443] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Analysis in control (vector only transfected HEK293T lysate) and PPAPDC2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDP1/PPAPDC2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PAHNQMDMFVTLSVDKYSFPSGHATRAALMSR
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLPP6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PDP1/PPAPDC2 Protein (NBP1-83443PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PDP1/PPAPDC2 Antibody - BSA Free

• bA6J24.6
• EC 3.1.3
• EC 3.1.3.-
• FLJ46512
• FLJ90191
• MGC15483
• PDP1
• phosphatidic acid phosphatase type 2 domain containing 2
• Phosphatidic acid phosphatase type 2 domain-containing protein 2
• polyisoprenoid diphosphate phosphatase type 1
• PPAP2 domain-containing protein 2
• presqualene diphosphate phosphatase
• PSDP

Background

Phosphatase that dephosphorylates presqualene diphosphate (PSDP) into presqualene monophosphate (PSMP),suggesting that it may be indirectly involved in innate immunity. PSDP is a bioactive lipid that rapidly remodels topresqualene monophosphate PSMP upon cell activation. Displays diphosphate phosphatase activity with a substratepreference for PSDP > FDP > phosphatidic acid

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLPP6