PDK2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PDK2 Antibody [NBP1-87307] - Staining of human cell line A-431 shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PDK2 Antibody [NBP1-87307] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PDK2 Antibody - BSA Free (NBP1-87307) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-PDK2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KTSFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGSTN
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reported in the literature (PMID: 30457021 and 25991547).
• Control Peptide:

  PDK2 Protein (NBP1-87307PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25991547).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PDK2 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.2
• lipoamide, kinase isozyme 2, mitochondrial
• PDH kinase 2
• PDHK2
• PDK2
• PDKII
• Pyruvate dehydrogenase kinase isoform 2
• pyruvate dehydrogenase kinase, isoenzyme 2
• pyruvate dehydrogenase kinase, isozyme 2

Background

PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PDK2 Antibody (NBP1-87307)(3)

Publications using NBP1-87307

• �korja Mili? N, Dolinar K, Mi� K et al. Suppression of Pyruvate Dehydrogenase Kinase by Dichloroacetate in Cancer and Skeletal Muscle Cells Is Isoform Specific and Partially Independent of HIF-1? International Journal of Molecular Sciences 2021-08-10 [PMID: 34445316] (Immunocytochemistry/ Immunofluorescence, Mouse)
• Hu T, Yu S, Li Y et al. PDK2 induces Cisplatin-resistance in lung adenocarcinoma via transcriptional regulation of CNNM3. Journal of Drug Targeting. 2018-11-20 [PMID: 30457021] (WB, Human)
• Hou X, Zhang L, Han L et al. Differential function of pyruvate dehydrogenase kinases during mouse oocyte maturation. J. Cell. Sci. 2015-05-19 [PMID: 25991547] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: PDK2