PDK2 Antibody

Images

 
Western Blot: PDK2 Antibody [NBP1-87307] - Analysis in control (vector only transfected HEK293T lysate) and pDK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: PDK2 Antibody [NBP1-87307] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: PDK2 Antibody [NBP1-87307] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KTSFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGSTN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDK2 Protein (NBP1-87307PEP)
Publications
Read Publication using
NBP1-87307 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25991547).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDK2 Antibody

  • EC 2.7.11
  • EC 2.7.11.2
  • lipoamide, kinase isozyme 2, mitochondrial
  • Pyruvate dehydrogenase kinase isoform 2
  • pyruvate dehydrogenase kinase, isoenzyme 2
  • pyruvate dehydrogenase kinase, isozyme 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-2383
Species: Hu
Applications: WB, ICC/IF
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56992
Species: Hu
Applications: IHC-P
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32581
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDK2 Antibody (NBP1-87307)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for PDK2 Antibody (NBP1-87307) (0)

There are no reviews for PDK2 Antibody (NBP1-87307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDK2 Antibody (NBP1-87307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDK2 Products

Bioinformatics Tool for PDK2 Antibody (NBP1-87307)

Discover related pathways, diseases and genes to PDK2 Antibody (NBP1-87307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDK2 Antibody (NBP1-87307)

Discover more about diseases related to PDK2 Antibody (NBP1-87307).
 

Pathways for PDK2 Antibody (NBP1-87307)

View related products by pathway.

PTMs for PDK2 Antibody (NBP1-87307)

Learn more about PTMs related to PDK2 Antibody (NBP1-87307).
 

Research Areas for PDK2 Antibody (NBP1-87307)

Find related products by research area.

Blogs on PDK2

There are no specific blogs for PDK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDK2