PDK2 Antibody (7X6R7)

Western Blot: PDK2 Antibody (7X6R7) [NBP3-16314] - Western blot analysis of extracts of various cell lines, using PDK2 Rabbit mAb (NBP3-16314) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

Immunohistochemistry-Paraffin: PDK2 Antibody (7X6R7) [NBP3-16314] - Immunohistochemistry of paraffin-embedded human colon using PDK2 Rabbit mAb (NBP3-16314) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 7X6R7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PDK2 Antibody (7X6R7) Summary

• Description: Novus Biologicals Rabbit PDK2 Antibody (7X6R7) (NBP3-16314) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 308-407 of human PDK2 (Q15119). YSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PDK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PDK2 Antibody (7X6R7)

• EC 2.7.11
• EC 2.7.11.2
• lipoamide, kinase isozyme 2, mitochondrial
• PDH kinase 2
• PDHK2
• PDK2
• PDKII
• Pyruvate dehydrogenase kinase isoform 2
• pyruvate dehydrogenase kinase, isoenzyme 2
• pyruvate dehydrogenase kinase, isozyme 2

Background

PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDK2