PDI Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PDI Antibody [NBP2-49086] - Staining of human cell line Hep G2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human lymph node.
Immunohistochemistry: PDI Antibody [NBP2-49086] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human pancreas shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining in human pancreas and colon tissues using anti-PDIA2 antibody. Corresponding PDIA2 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human kidney, liver, lymph node and pancreas using Anti-PDIA2 antibody NBP2-49086 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human liver.
Immunohistochemistry-Paraffin: PDI Antibody [NBP2-49086] - Staining of human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDI Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTV
Specificity
Specificity of human PDI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDIA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDI Recombinant Protein Antigen (NBP2-49086PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDI Antibody

  • Pancreas-specific protein disulfide isomerase
  • pancreatic protein disulfide isomerase
  • PDA2
  • PDI
  • PDIp
  • PDIPEC 5.3.4.1
  • PDIR
  • protein disulfide isomerase A2
  • protein disulfide isomerase family A, member 2
  • protein disulfide isomerase, pancreatic
  • protein disulfide isomerase-associated 2
  • protein disulfide-isomerase A2
  • Rho GDP dissociation inhibitor gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, PA, B/N, KD
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, Gp, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB110-40548
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-76846
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-62489
Species: Hu, Mu, Dr
Applications: WB

Publications for PDI Antibody (NBP2-49086) (0)

There are no publications for PDI Antibody (NBP2-49086).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDI Antibody (NBP2-49086) (0)

There are no reviews for PDI Antibody (NBP2-49086). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PDI Antibody (NBP2-49086) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PDI Products

Bioinformatics Tool for PDI Antibody (NBP2-49086)

Discover related pathways, diseases and genes to PDI Antibody (NBP2-49086). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDI Antibody (NBP2-49086)

Discover more about diseases related to PDI Antibody (NBP2-49086).
 

Pathways for PDI Antibody (NBP2-49086)

View related products by pathway.

PTMs for PDI Antibody (NBP2-49086)

Learn more about PTMs related to PDI Antibody (NBP2-49086).
 

Research Areas for PDI Antibody (NBP2-49086)

Find related products by research area.

Blogs on PDI.

ERO1 Activity: A Potential Source of ER-Derived Oxidative Stress.
Disulfide bond formation is a pivotal step in the maturation and release of secretory proteins that are controlled by specific endoplasmic reticulum (ER) resident enzymes. An important element in this process is ERO (ER oxidoreduction), a glycosylated...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIA2