PDGFR alpha Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PDGFR alpha Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDGF R alpha.
  
  

  Source: E. coli

  Amino Acid Sequence: EVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PDGFRA
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76508.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PDGFR alpha Recombinant Protein Antigen

• alpha-type platelet-derived growth factor receptor
• CD140 antigen-like family member A
• CD140a antigen
• CD140a
• EC 2.7.10
• EC 2.7.10.1
• MGC74795
• PDGF R alpha
• PDGFR alpha
• PDGFR2
• PDGFRA
• PDGFRA/BCR fusion
• PDGF-R-alpha
• platelet-derived growth factor receptor, alpha polypeptide
• rearranged-in-hypereosinophilia-platelet derived growth factor receptor alphafusion protein
• RHEPDGFRA

Background

Platelet-derived growth factor receptors exhibit tyrosine-protein kinase activity and have been implicated in the control of cell proliferation, survival and migration. PDGF receptors, PDGFR-alpha and PDGFR-beta, have 5 extracellular immunoglobulin-like domains and an intracellular tyrosine kinase domain. Upon binding a PDGF, the receptors form homo-and heterodimers. Dimerization of the receptors results in phosphorylation in the complex. More than 10 different SH2-domain-containing molecules have been shown to bind to different autophosphorylation sites in the PDGF-alpha and beta receptors. PDGF alpha receptors are expressed in oligodendrocyte progenitor cells and PDGF beta receptors are expressed on neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PDGFRA