PDE6D Antibody

Images

 
Western Blot: PDE6D Antibody [NBP1-86275] - Analysis in control (vector only transfected HEK293T lysate) and pDE6D over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDE6D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE6D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PDE6D Protein (NBP1-86275PEP)
Publications
Read Publication using
NBP1-86275 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24166846).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDE6D Antibody

  • GMP-PDE delta
  • PDED
  • phosphodiesterase 6D, cGMP-specific, rod, delta
  • Protein p17
  • retinal rod rhodopsin-sensitive cGMP 3'-5'-cyclic phosphodiesterase subunitdelta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB120-5663
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6638
Species: Hu, Mu, Rt
Applications: WB
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86275
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PDE6D Antibody (NBP1-86275)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PDE6D Antibody (NBP1-86275) (0)

There are no reviews for PDE6D Antibody (NBP1-86275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDE6D Antibody (NBP1-86275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE6D Products

Bioinformatics Tool for PDE6D Antibody (NBP1-86275)

Discover related pathways, diseases and genes to PDE6D Antibody (NBP1-86275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE6D Antibody (NBP1-86275)

Discover more about diseases related to PDE6D Antibody (NBP1-86275).
 

Pathways for PDE6D Antibody (NBP1-86275)

View related products by pathway.

PTMs for PDE6D Antibody (NBP1-86275)

Learn more about PTMs related to PDE6D Antibody (NBP1-86275).
 

Research Areas for PDE6D Antibody (NBP1-86275)

Find related products by research area.

Blogs on PDE6D

There are no specific blogs for PDE6D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE6D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE6D