Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: PDE6D Antibody [NBP1-86275] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and no positivity in cells in glomeruli as expected.
Novus Biologicals Rabbit PDE6D Antibody - BSA Free (NBP1-86275) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-PDE6D Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRL
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE6D
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for PDE6D Antibody - BSA Free
GMP-PDE delta
PDE6D
PDED
phosphodiesterase 6D, cGMP-specific, rod, delta
Protein p17
retinal rod rhodopsin-sensitive cGMP 3'-5'-cyclic phosphodiesterase subunitdelta
Background
PDE6D is the effector enzyme in the G protein-mediated signal transduction cascade in the visual system. The second messengers cAMP and cGMP are key regulatory molecules that are involved in a wide variety of signal transduction pathways, such as insulin secretion, platelet aggregation, smooth muscle relaxation, olfaction, and vision. Levels of cAMP and cGMP are regulated by their rate of synthesis by nucleotide cyclases and by their rate of hydrolysis by cyclic nucleotide phosphodiesterases (PDEs). PDEs form a superfamily of enzymes that catalyze the conversion of 3-prime, 5-prime-cyclic nucleotides to the corresponding nucleoside 5-prime-monophosphates. While mammalian PDEs are divided into major families based on their substrate specificities, kinetic properties, allosteric regulators, inhibitor sensitivities, and amino acid sequences, each family and even members within a family display distinct tissue, cell, and subcellular expression patters. This suggests that individual PDE family members are involved in discrete signal transduction pathways. There are five different subunits consisting of rod and cone specific catalytic subunits: alpha® (Cone), alpha (Rod), and beta (Rod), the inhibitory subunit gamma, and subunit delta of unknown function (which likely interacts with many other proteins besides the PDE6 family). The catalytic core of the PDE6 system is comprised of alpha®/alpha® homodimers in the cone and alpha/beta heterodimers in the rod. The C-terminus of both the catalytic and inhibitory subunits is modified by methylation, myristyolation and prenylation which have been shown to be critical for proper complex assembly and membrane association.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PDE6D Antibody - BSA Free and receive a gift card or discount.