PDCD5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PDCD5 Antibody [NBP1-82656] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: PDCD5 Antibody [NBP1-82656] - Staining in human testis and pancreas tissues using anti-PDCD5 antibody. Corresponding PDCD5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PDCD5 Antibody [NBP1-82656] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: PDCD5 Antibody [NBP1-82656] - Staining of human testis shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDCD5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PDCD5 Antibody - BSA Free (NBP1-82656) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDCD5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PDCD5 Protein (NBP1-82656PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PDCD5 Antibody - BSA Free

• FLJ42784
• MGC9294
• PD5
• PDCD5
• programmed cell death 5
• programmed cell death protein 5
• Protein TFAR19
• TF-1 cell apoptosis-related protein 19
• TFAR19 novel apoptosis-related
• TFAR19
• TFAR19TF1 cell apoptosis-related gene 19

Background

The PDCD5 gene encodes a protein expressed in tumor cells during apoptosis independent of the apoptosis-inducing stimuli. Prior to apoptosis induction, this gene product is distributed in both the nucleus and cytoplasm. Once apoptosis is induced, the level of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDCD5